CAZyme Information: PHYSODRAFT_257758-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_257758-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	JH159152|CGC1	66026.21	5.4544

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:8683596-8685326(+)

Full Sequence      

MDIYCRGPLLHAVQMANVFSDSKYFVDMPIKDNSSAFDILMDFQRRGLAMTEYRPNVHDT
HEQQLRRFVDDHFDPPGTDLLPITPFDFQGQSHPPMIAEIQDDELRDWAFDLHRIWQTLG
RIRNPNVRGSLLRARKLEEPSLNRPANVLIVPGGRFRESYYWDSYWIVQGLLVSDMPITA
RGIVDHLLEYVSEFGFVPNGGRIYYLTRSQPPMLSDMVKLVARFPTNGNESGYDEGYLRA
ALPILEREYDFWMQHGPCGHAVQLTRRNMSEGATGRATYVLNRYTSNANHPRPESYREDV
LVAAEIFDRTMQMDDGNAAATERHKDKYYNNVIAAAESGWDFSSRWLRDPLDMKSMVTTS
VVPVDLNSIMYRFECNLMEFNRHLGNEERAQFFERAAARRLEAIDAILWSEKHHSWKDYD
LETDTHSPIVSVSDYTPLWAKAFNSSDIDRLKHVVTSLKNSGLLQVGGVQTTTIFSGQQW
DSPNAWPPEQDIVVEGLLAVNTTESHSLARELSQTWTQTSLTAWRQTGLMFEKYNTSEVG
GLGTGGEYFPQFGFGWTNGVILKFLTIHQNLLLAEH

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	19	566	2.1e-161	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	0.0	4	565	13	541	alpha,alpha-trehalase
395961	Trehalase	9.19e-162	19	568	3	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	2.77e-96	3	566	55	550	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	2.92e-94	7	565	49	533	alpha,alpha-trehalase TreA.
183936	treA	1.12e-90	9	568	52	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20368.1|GH37	0.0	1	575	175	749
CCA17719.1|GH37	6.71e-250	1	572	125	705
CCA18365.1|GH37	6.71e-250	1	572	125	705
CCA21422.1|GH37	8.33e-238	1	573	163	745
AOW41677.1|GH37	9.08e-225	1	572	48	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	7.29e-112	21	576	40	567	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.13e-110	21	576	40	567	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	7.09e-85	7	565	52	536	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	6.71e-80	7	567	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.64e-75	7	567	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8J4S9|TREA_APIME	2.77e-129	2	575	44	575	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|Q54QZ5|TREA_DICDI	6.45e-122	3	565	53	582	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9W2M2|TREA_DROME	4.70e-119	3	568	55	577	Trehalase OS=Drosophila melanogaster OX=7227 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	6.19e-116	2	574	31	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	7.13e-116	3	574	29	553	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_257758-t26_1-p1.