CAZyme Information: PHYSODRAFT_257416-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_257416-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: pectin methyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		36364.31	9.8048

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:1878823-1879842(+)

Full Sequence      

MQLLAPLIALLGLAAAVEAGCGGPTARVTPPPGSIVVDATGAHRGSFRTLSQGVAKLSAS
TTPQTIFVYPGVYKEQVVVPKLNGPLILQGYTCNTMAYTSNQVTITQAKAQKDIPASITK
NRNDLTATLLLKSDNVKVYNLNVANTAGNVGQAIAVKADGANMGFYACKFLGYQDTLYAN
KGPNLYAKSYISGAVDFVFGQYAKAWFESCDIVSIAKGCITANGRDSAANPSEYVFNNAR
VTGNGGVGTAYLGRPWKPYSRVIWQNSDFSNVINPEGWQKWNGDNNVANIHFKEFNNRGA
GAAVNKRVGFSGRLAKPVPITDILGANYKTQWWVDTRYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	36	311	1.9e-76	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	5.17e-51	38	312	1	276	Pectinesterase.
178051	PLN02432	1.73e-50	35	332	13	291	putative pectinesterase
178372	PLN02773	6.05e-46	44	314	14	282	pectinesterase
215173	PLN02304	6.27e-42	30	314	67	354	probable pectinesterase
215130	PLN02217	1.09e-41	24	312	244	526	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	5.89e-176	1	339	1	338
AFM08806.1|CE8	8.36e-176	1	339	1	338
ABQ63096.1|CE8	8.23e-159	13	339	15	344
ACO54873.1|CE8	2.35e-158	13	339	15	344
ACO54868.1|CE8	9.87e-143	1	339	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.33e-57	27	338	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.92e-57	27	338	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.52e-33	34	312	8	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.50e-30	45	312	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.48e-14	58	302	61	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	7.94e-78	13	339	6	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.17e-77	13	338	6	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.04e-64	27	338	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.04e-64	27	338	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.14e-63	27	338	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000292	0.999677	CS pos: 19-20. Pr: 0.9550

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_257416-t26_1-p1.