CAZyme Information: PHYSODRAFT_253600-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_253600-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: putative endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	JH159151|CGC3	73352.63	4.3180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:6241520-6243840(+)

Full Sequence      

MNGERPESPSETLFQRKDGLAALAPIINVAEALNAQPIPTNKWWGNLIHTTNEDVDSVAN
PAWSNPYALKLPKQAPFGLQACYSYTYRQLADEVDGVIRYYLHEFHNDVTLSASEFGSTK
PDYEIYSFSDMGVALRTCVAGSSDSDSFNCMDSALVHGMAFVSAAYAGLTPRIESDYAMT
LLDSSTPGKYVVRLANNQTWVAFASDPSVTFSVESTGSALTAAAGYTGTVRLAVLPESGD
QNVYDDYASCVVRGGDVSVQSRTSYSLDWETGGSGCDSSGLLHFALPHHLDAIDNPTTTQ
LSGAIVLHSSTRGLMVGQVTTSGSWTLSEPEADDEVDFYPASKPSADVVSQIGLLSTLQS
DIESTWTLDTGSWYYNGKEYQKYASLCLMAADSSVVGDDTTLLKSCLSKLETLIEPFLNN
TVSVPLVYETTYNGIVTSQVFTSDDVNVEFGNGVYNDHHYHYGYWVTASAILKKLDPSWS
GMAQLETMVWTLLRDVANPSSDDEYFPRFRHFSWYLGHSYSHGVTPMADGKDEESTSEDV
NFYYGMMLWGKVTQNQAVEDLGSLMLRLNARAVRTYFLMTSDNTIHPPQFVPNHVTGIFF
DNKADYATWFSAEKYCIHGIQMIPVSPINGLVRTAKFIQQEWDDILSKEAIVTGADTTNA
WLSLLLV

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_253600-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	29	665	5.8e-171	0.9212218649517685

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.02e-136	345	665	3	313	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	4.59e-131	37	665	89	713	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.79e-55	37	342	14	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	7	667	51	705
UIZ26440.1|GH81	0.0	7	667	51	705
UIZ26131.1|GH81	7.07e-295	7	667	19	679
UIZ26137.1|GH81	2.55e-290	7	667	129	789
UIZ26602.1|GH81	2.55e-290	7	667	129	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.46e-93	30	646	33	666	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.46e-93	30	646	58	691	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.18e-89	30	646	33	666	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.19e-26	22	646	18	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.94e-21	456	624	439	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.44e-97	34	643	31	642	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	5.76e-88	37	665	225	860	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.55e-85	12	642	413	1050	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	5.63e-84	34	644	107	719	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.46e-82	34	644	457	1082	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_253600-t26_1-p1.