CAZyme Information: PHYSODRAFT_253210-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_253210-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
786	JH159152|CGC2	85723.42	6.2699

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:4404873-4407233(-)

Full Sequence      

MKISASALIGLGALLQVAEVSAQAFSKSGSSSLGGDLPVVGPSDAPVSNETISSPEAASA
ATGAPSTPIVGGGNSSTLGASEPPSYLVEHTDAMMGLCPPKYLDSSVIKNRAIPTNNWWG
NIIAHDSNAAIQPIWPNPYSLQMVVDNAPFGMSVSYPYRNRFSGGSSGNNGAVKFYAHGQ
VREFMFSAVEMQQKPNFQVVDWADQGVTVKFSASSSSGTMVSDLVSGMVYTSMKYSGLTP
RLVSSAAISSVNGQPLGGQVRGSKFVIAYNSGQKWVVYALSSDGRSEQEITLTADGNTAL
MSTAAFDGILRVALVDDDSWLSTLDQHKSCVVQAATVDLRDESSYAFKWKTTGDCSVGLL
HFAMKHQVESIDTSAGARKVDGMVAYSTTRGAYQAFTTPGGSADPVWEIKETQPVPEDFY
PARKIASAVTQQQRVLDHLREDINAAWSIPLDGSYYFNGKAAQKYASLCLIANDAAVVGG
DKSLLNTCLAKLRGVMTPFVTNSWANKLQYDQIYGGIVSSQGFKTKDLNSDFGNTMYNDH
HFHYGYWVHTAAIVNRLDPTWSELGKLNTMANLLVRDVANYDPEDKFFTRFRSFDWFRGH
SYSHGVTPFADGKDQESTSEDVNFAFGMYMFGKVTNNAALEAVGKLMTRVNAHAIKTYFL
IEDANQIHPTNFRPNKVTGIFFDNKVDYATWFSAEKHCIHGIQMIPVSAVTEFVRTKQFV
KEEWEQVLSKEMIVTREDTGNSWLSLLYANFAMVDKQRALGVLQKAKMDDGLSRSWALYM
AASFAE

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_253210-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	106	779	6.2e-182	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	5.10e-156	439	778	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.89e-139	51	785	13	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.47e-44	113	398	15	300	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20872.1|GH81	0.0	1	786	1	794
UIZ20875.1|GH81	0.0	1	786	1	794
UIZ20868.1|GH81	0.0	1	786	1	794
UIZ20873.1|GH81	0.0	1	786	1	794
CCA25006.1|GH81	3.58e-285	77	785	28	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.23e-99	100	783	30	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.43e-98	100	783	55	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.35e-95	100	783	30	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.50e-32	112	775	34	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.20e-24	99	772	35	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.71e-96	99	782	24	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	9.69e-89	113	782	226	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.58e-85	199	782	163	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	1.42e-78	113	785	111	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	9.02e-74	100	785	421	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999740	CS pos: 22-23. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_253210-t26_1-p1.