CAZyme Information: PHYSODRAFT_251422-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_251422-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: cellulase-4, endo-1,4-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		64877.85	4.4811

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8496876-8498728(+)

Full Sequence      

MEVSVVRPMPPKSSGASSVGGAPAPTGGDPPSSSYRNSEYTSGRASAYLDRTSDYGRDTM
SMSQRQTEMKLMAMDPSEDSPPERVQDYKGRIRTWRGLILLCVIVGGAAAIITACALQAN
EDATNRQAKYENRVEERRKINDGLTDDQVIISDDGQVGNPKSYPDMGCELPDYQSKNGQI
FAVSKNGTEVPVGIKGVNWFGMETGLAIPFGLWENMDNGTSVYEIAAFLARNKFNSVRLP
VCIKNILKNTPPEKTLINVNTNRAINITTYISTIESIVEALGYRHITVMISLHTLDIKKS
GGAWYSDELDVTEDEFLEAVDILTKNLCSSKYWNILGLDLKNEPHECSWGGKAPDWQKGS
SLIGNRMLEGCPNWMAFVEGIASSGTVTVGSRTATYFDWWGGGLEEAGANPTELTVSNKL
VWAPHYYNTGVYPAWYLYASTGAVDASGAFSSYVELDDEELRANVETTMDVMFGYLLGVD
TNSAMVMGEFAGLYSKDKHPKLTTKRTTDFTIEVMLKAGYAGGYMWSLNPESAYQYNPAD
TYGTFTEGLLEDDWLTPNKVFLEGIAALNDVKDLKMFPCFPQEVSSSSSSS

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_251422-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	189	532	4.3e-151	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.58e-16	177	582	32	404	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.76e-06	224	432	28	200	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC87087.1|GH5_20	0.0	1	591	1	591
ABK59035.1|GH5_20	0.0	1	591	1	591
ABG80550.1|GH5_20	0.0	1	590	1	584
ABG80551.1|GH5_20	0.0	1	590	1	584
ABL75352.1|GH5_20	0.0	1	587	1	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	4.32e-38	173	556	8	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	5.93e-38	173	556	8	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.89e-37	173	556	41	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	2.58e-37	173	556	41	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	9.01e-37	173	556	41	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19487|GUNA_XANCP	4.81e-27	192	554	42	354	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P54583|GUN1_ACIC1	3.93e-25	190	560	60	383	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	3.46e-17	183	432	638	896	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

Start	End
98	120