CAZyme Information: PHYSODRAFT_250672-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_250672-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: cutin hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		22123.19	6.2090

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159157:815622-816275(-)

Full Sequence      

MKFATPFSAVLGSILLFANPINLVSAECSDVHVVFARGSGEMQGLGICGEPLVSGITSNL
GGKSVSSYAVNYMASMDQSSAGPGATDMTNHVVSVAQECPNTVFVLGGYSQGASVTDIAI
GIKTSLGSGDTIPENLAPRIKAVVTFGNPLKLMGQTIESSSPTYGPKAIEFCAQGDPVCG
NGFNTMAHMTYTTDGSVTTAAQKAAALVSGGGRKLRM

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_250672-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	203	1.7e-53	0.9682539682539683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.04e-43	28	208	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY60079.1|CE5	2.63e-116	1	216	1	214
AAY43367.1|CE5	1.45e-113	1	210	1	208
AAO92431.1|CE5	5.23e-111	1	212	1	213
AAO92430.1|CE5	5.23e-111	1	212	1	213
AAX55266.1|CE5	2.59e-105	1	216	1	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.51e-16	28	200	79	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
2CZQ_A	6.58e-13	25	211	3	203	A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2],2CZQ_B A novel cutinase-like protein from Cryptococcus sp. [Cryptococcus sp. S-2]
1BS9_A	4.74e-12	27	194	1	193	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
2AXE_A	4.74e-12	27	194	1	193	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1G66_A	6.54e-12	28	194	2	193	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	1.30e-61	25	212	33	222	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P9WP43|CULP1_MYCTU	3.31e-38	5	205	2	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1
sp|P63880|CULP1_MYCBO	3.31e-38	5	205	2	210	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1
sp|P9WP42|CULP1_MYCTO	3.31e-38	5	205	2	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	1.66e-36	28	208	44	222	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999757	CS pos: 26-27. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_250672-t26_1-p1.