CAZyme Information: PHYSODRAFT_250556-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_250556-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397	JH159157|CGC5	43750.14	8.8049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159157:509583-510949(+)

Full Sequence      

MERCVVTFAAATRACVTLLALATAAIVTPYDTSSHLQAGGSSLAALSNWDGVYFSHIARS
GYDFEHFHAFFPLYPLLARWLAHLLPLDEASAVVASGWVISNASFVLAALCLYRLGCVVL
RDEVVARRAAYLFCVAPSSIFMSAVYSESLMCLLSFSGMYFLARHAQAPKPRRAFRDLVY
CALLFGAASATRSNGILLSFLGALAVGPQVAYFVVAMVPYCPSIVQRFGGEALATGAEMQ
DRSWCAKAVPNFTAMYTFIQSEYWNVGLFRYYELKQVPNFLLAAPIIGLSLHALQGYFRG
LVVPGRPSFASQEQQVRSWRGTALTPYYVHWLFLVVTTRLLCACPPLFWHPAALLCGSTG
KRKESPILTTYGRLVVGYFLLFTVLGSVLFPSFYPWT

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_250556-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	5	397	2.2e-86	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.88e-44	5	397	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.45e-15	46	294	71	316	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	9.45e-217	2	397	6	439
CCA18790.1|GT76	6.50e-98	2	397	6	490
ACO67127.1|GT76	1.17e-52	13	397	13	421
BAF29832.1|GT76	3.97e-46	5	397	8	486
BAT17237.1|GT76	3.97e-46	5	397	8	486

PDB Hits     

PHYSODRAFT_250556-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5KR61|PIGV_RAT	4.12e-34	43	397	60	492	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.27e-31	43	397	60	493	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q290J8|PIGV_DROPS	9.94e-31	42	397	59	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q9NUD9|PIGV_HUMAN	1.42e-29	43	397	60	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.92e-29	39	395	71	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002043	0.997918	CS pos: 24-25. Pr: 0.9528

TMHMM  Annotations     

Start	End
5	27
94	116
129	151
196	218
327	349
374	396