CAZyme Information: PHYSODRAFT_250546-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_250546-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: cutin hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		22058.20	6.2104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159157:817422-818075(+)

Full Sequence      

MKFASACSTLLGSLVVLVANPANLVSAECSDVHVVFARGSGEMQGLGICGEPLVSGITSN
LGGKSVSSYAVNYMASMDQSSAGPGATDMTNHVVSVAQECPNTVFVLGGYSQGASVTDIA
IGIKTMLGSGDTIPENLAPRIKAVVTFGNPLKLMGQTIESSSPTYGPKAIEFCNQGDPVC
GNGFNTMAHMTYPMDSVSGAAEKAAALVKGGGRKLRA

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_250546-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	28	202	8e-53	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.51e-44	29	208	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY60079.1|CE5	1.64e-126	1	217	1	215
AAY43367.1|CE5	1.50e-122	1	210	1	208
AAX55266.1|CE5	8.17e-109	1	216	1	216
AAO92431.1|CE5	5.80e-108	1	212	1	213
AAO92430.1|CE5	5.80e-108	1	212	1	213

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.51e-16	29	201	79	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
4OYY_A	3.89e-12	29	201	17	185	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
1CUZ_A	9.95e-12	26	202	28	201	Chain A, CUTINASE [Fusarium vanettenii]
1BS9_A	1.72e-11	28	192	1	190	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
2AXE_A	1.72e-11	28	192	1	190	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	2.67e-58	26	212	33	222	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P9WP38|CULP3_MYCTO	1.82e-35	29	185	44	204	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|P0A537|CULP3_MYCBO	1.82e-35	29	185	44	204	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	1.82e-35	29	185	44	204	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|P9WP42|CULP1_MYCTO	4.57e-35	29	206	35	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999754	CS pos: 27-28. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_250546-t26_1-p1.