CAZyme Information: PHYSODRAFT_247428-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_247428-t26_1-p1
• CAZy Family: AA17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
991		112770.35	6.5846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:7389432-7392901(+)

Full Sequence      

MASSSTLVPLAVAAVGGLALYGLLRVARARIYDATIVKLTTGWYAEVLRRLPADSKMLDV
GIGTGLALANNGDQLRAKRIEVDGVDYDADYVTRCRALLGERQLASCVQVHHASIYDFSG
PGPYDAVYFSSSLMLMPDAVKALQHCAAMLKPKTGRVYVTQTIQTSHSTLVEIGKPLLKF
LTTIDFGHVTYERELLTTFKKAGLTLLEHVPISGSTMTSTRSFRLFGLGGGVEASVARLK
KNAEPHDPVAATRGLINRRLGPKYNDQISLRVLPSDSDELDVFELGSDGDKLEIAANSAT
AMAYGLQWYFKSVLRTQTDWENHKLQLPDKLPKVDERVRHKRSSKFSYYQNVDTGSYSLW
AWSWPQWEKHIDWMALNGINMPLAFTGQEKVWQNTFHKYYNVSYEGLGKFFAGSAFLSWG
RMGNLRGSWVKGPLPQAFIDNQHELQLRILQRMREFGMIPALPAFAGHVPEDLKLTLPNA
NFTRSPNWGNFTDQYCCVYMIEPTDPLYREIGKAFLEEQRALYNYTSSLYQCDTYMEMAP
EFTDLSELKGAARAVIDGMTAADPNAVWLMQGWPFVDDPHYWTRPRVKAYLEGVPTDKLI
ILDFYSEAVPIWNKMDNYFGKNWIYSVLHNFGGNTGMRGDLPTLATAPVQAQRDGNGTMV
GVGLTMEGIFQNYVVYDLTLQMAWEDSPLDVDEWVSKYASRRYHTQNEHVERAWSYLSRS
VYNRTLAYGGVTKSLVCLIPHWRLLYDRFQPTLIKYDPKDIVLAWKELLLAGDELRNVDT
YRHDLVDVTKQFLSNKLLEQYQHLKVIYSAKSAPANEVCELTKTMLTTINRLEEILATNE
DFLLGNWVADALNLAGDLNIGGDSVTRTKLQEYYEYEARNQVTRWGDNNNEAIHDYAGKE
WAGLVKSYYLPRWTMWLTEVCSAYTDRREMDEKGLKKRRIAFELKWQLSHEKYPTTTVGD
SFSISKRIYSEYTDTNVVVPWDFFEADVAVM

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	289	969	1.5e-215	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.21e-179	348	686	2	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	2.12e-91	694	966	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	1.29e-21	250	332	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
404528	Methyltransf_25	6.96e-13	58	152	2	95	Methyltransferase domain. This family appears to be a methyltransferase domain.
400515	Methyltransf_12	6.55e-09	58	152	1	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56008.1|GH89	1.45e-296	223	982	3	746
AIG55486.1|GH89	5.56e-288	246	973	22	730
AIG56414.1|GH89	6.45e-235	215	973	3	749
AIG55749.1|GH89	9.13e-222	246	972	28	748
AIG56322.1|GH89	7.07e-215	246	972	30	747

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	7.06e-144	250	981	7	720	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	2.65e-80	253	977	175	882	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.01e-80	253	977	183	890	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.51e-79	253	977	198	905	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	1.40e-165	250	972	47	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	7.08e-143	250	981	30	743	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000012

TMHMM  Annotations     

Start	End
7	29