CAZyme Information: PHYSODRAFT_246597-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_246597-t26_1-p1
• CAZy Family: AA16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		56939.02	4.4911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:884819-886413(+)

Full Sequence      

MKAVAALMSLGLATSALATPSWHDLAITAPRYGRHCLGARPQAEQDVHRSIDFYLKTRAE
QGYNAVQTVVISENNGTTRPNFYGDLPFNDSDTTKPNEAYFELVDWTVDLAASYGILMVL
VPAWGNWISGGWHGTEEPLFNDLTAYDWGKFIGDRYPGVPKILGGDTNCLWARNLMASSI
SYASSPDVDPATLVGTIEDTTHLWTSMRSGLKDGEEAQGYEPVILFHPTAGRIARPLSTP
EALGHLMLPKEEDRVSIDAVQSGHATPESLGAFTPFEARDSTKNYELIAAMRDGFTGPVL
DLENHYEGAHYNFDPNYPIWNSSEVRTGLYNAVYSGAAGFTYGANSVWQMYEPRSDLLRD
SDYYAPSVNQNVSGSWRRDIFFEGATQIQYVTKPLQNRTIEELELLQPARHLLSSPRGYS
DVAVNAFESTRFISVLASGTHDRYYVYTGHGDSFSLELGNGSERSGVARWFSPRDGQYYA
DSMVTVAANGDDARVDFTPPSGEGVDNDWVLVLEF

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_246597-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	51	511	2e-61	0.9053398058252428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	6.48e-99	51	398	32	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.65e-11	442	514	25	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	1.95e-128	22	514	28	534
KAF3763706.1|GH140	9.11e-123	22	513	27	535
KNX49908.1|GH140	2.38e-63	49	513	51	517
KAB8276359.1|GH140	2.09e-61	54	514	68	508
KAE8313632.1|GH140	4.22e-60	54	514	68	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	9.12e-12	52	513	55	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	3.57e-10	52	513	55	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYSODRAFT_246597-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000334	0.999639	CS pos: 18-19. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_246597-t26_1-p1.