CAZyme Information: PHYSODRAFT_245865-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_245865-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		36895.29	5.1902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:3844703-3845737(-)

Full Sequence      

MQIIAPLVALAGLATGALADSTCSGPNVRTQPPAGAIVVDATGSYKNSFKTVSEGVARLD
PNTTSEQTIFLRPGVYNEQVLISPLSGPLVLQGFTCDASTYTKNEVTITQAKAQKDIPAE
VKGEARNDMTSTVRFKSDKVKVYNLNIANTAGNVGQALAVNVNATDYGFYACNLTGYQDT
VLADKGKELYAKTYINGATDFVFGRYAQAWFESCDIETIGTGYITASGREAANSSATYVF
NRARVFGKSGVNSTVLGRPWRPYAKVIWQNSELGDVVKPQGWATWDATSSTANVVFKEFN
NSGPGAVKGSRVAFSGQIDKPVAINEVLGEGYETEWWVDTTYLS

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	37	319	7.3e-70	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	6.95e-45	36	318	10	272	putative pectinesterase
178372	PLN02773	1.31e-39	31	318	1	282	pectinesterase
178113	PLN02497	6.00e-39	34	339	31	327	probable pectinesterase
395871	Pectinesterase	4.85e-37	37	316	2	276	Pectinesterase.
178098	PLN02480	3.58e-34	3	320	15	321	Probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54868.1|CE8	8.08e-218	1	343	1	343
ACO54869.1|CE8	4.24e-156	1	343	1	338
ABQ63096.1|CE8	3.43e-152	6	343	7	344
ACO54873.1|CE8	9.79e-152	6	343	7	344
ACO54874.1|CE8	4.82e-148	6	343	7	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	7.63e-60	29	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.08e-59	29	342	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	7.73e-30	21	316	2	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.01e-27	34	316	3	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.80e-12	47	306	46	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.87e-77	29	344	20	331	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	2.13e-73	29	342	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A1DBT4|PMEA_NEOFI	1.54e-68	29	342	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.82e-66	29	342	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.82e-66	29	342	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999749	CS pos: 19-20. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_245865-t26_1-p1.