CAZyme Information: PHYCI_99598T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_99598T0-p1
• CAZy Family: PL3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		38771.25	4.6307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0383:6686-7771(-)

Full Sequence      

MLSFKLLGAIVAFTSALLTKQSAAQFCIHGINYNPRNGPDWAAEDQRCKSSANIQADIST
LAQVSGSIRLYGLGDCDQVSSVVPVAINAGLSVSLGLWVSGDETVFEAEFNRLQTLIQQS
PGIFTGGSIVDIHVGSEAVYRKDITAEKNIEYLQRVKSLLAAYSLSSVPATIAEIGDVYL
AHPELTNAVDFVQANGFPFWEKIAVEDAVEYFDRRMTPLYQQAAALGKRVEIGETGWASG
GSSPKASEASPENAARYFFNFYQMAKARSLPFYYFEGFDEEWKIGTSNASVEGYFGLFHE
DRTLKTEIANLALGPSCPAGRNEDASASNTGSSTSGSQATDGSAESTPATVSPGGCRVRR
V

Enzyme Prediction     

No EC number prediction in PHYCI_99598T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	45	305	3.8e-24	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.43e-48	30	302	47	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.63e-15	65	305	37	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ90910.1|GH17	4.06e-90	11	309	11	310
UIZ28880.1|GH17	1.65e-85	15	308	3	297
AAM18482.1|GH17	6.60e-84	11	309	11	310
AIG56195.1|GH17	1.44e-71	9	313	3	312
AIG56146.1|GH17	2.00e-69	16	312	10	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.54e-34	29	308	38	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.86e-33	29	308	38	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	3.43e-07	220	311	291	386	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43070|BGL2_CANAX	8.69e-30	44	308	31	303	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	2.33e-29	44	308	31	303	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P15703|BGL2_YEAST	3.34e-26	45	308	37	308	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	8.57e-23	45	308	52	316	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|A2QN74|BTGC_ASPNC	1.12e-19	30	308	382	673	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999712	CS pos: 24-25. Pr: 0.8408

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_99598T0-p1.