CAZyme Information: PHYCI_98815T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_98815T0-p1
• CAZy Family: PL1
• CAZyme Description: Beta, beta-carotene 15,15'-dioxygenase and related enzymes

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		28985.07	5.5536

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0254:17360-18175(+)

Full Sequence      

MKLAVATAAIALVAHTVNAHGYLSQPAAYFPNGIDTKYNAILTESCDAAFAGLKWDDSPE
ANTAMFTKSFPNSQFKTLRAMMDTVATDCGNTALTGSPVDVSSLSSMKWQNDQEQMGFID
SHHGPCEAWIGDKRVFHSDDCRAAYTSYPAEIPIDYSSCSGDCTFTFYWLALHQPNWQVY
KQCAPIVNGSGGAQTAPSPTTTAPAVAQAAVSTTAPTQTDAPASDYTSTPVSTTASVSTT
TPSTESPETTSTSNCKARRRRRMTANLRSEN

Enzyme Prediction     

No EC number prediction in PHYCI_98815T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	8	250	4.2e-73	0.9673469387755103

CDD Domains     

PHYCI_98815T0-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ21309.1|AA17	4.77e-138	1	271	1	276
ETK95850.1|AA17	4.79e-126	1	271	1	295
ETM02278.1|AA17	1.60e-123	1	267	1	291
EEY61638.1|AA17	1.09e-110	26	271	59	327
ETI56033.1|AA17	3.60e-105	38	271	1	258

PDB Hits     

PHYCI_98815T0-p1 has no PDB hit.

Swiss-Prot Hits     

PHYCI_98815T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000231	0.999740	CS pos: 19-20. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_98815T0-p1.