CAZyme Information: PHYCI_96042T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_96042T0-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303		31993.33	3.8146

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0111:91651-92562(+)

Full Sequence      

MKIFSFVAATTLAMISSTNLADATTTGGVCYDPDHVDSVTESTISADFQTIKEKGFDLVR
TYVTTYGSADMATLAIAQGLNVSLGVPFDNDDPSATATYVTAAISAGALSNGSASVVQIF
VGNENLASVDSVPSEMLTYIKQLQAALPNVPIGTVQRNTEMLDSSRYSAISGLADLFTAC
DVVGVNIQPVFTANTAAADAITLVSDQWTELQGSDTESRFPGLADKLAITETGWPSAGSS
DGNTGSVAGAEQFYSDYMTWATENLDASRSHYFQMFDLPSRTDTVFEAHFGICDEDGNAK
FTL

Enzyme Prediction     

No EC number prediction in PHYCI_96042T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	45	303	1.3e-22	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.07e-17	5	292	24	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.001	227	303	229	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24978.1|GH17	5.29e-64	28	300	23	274
AIG55926.1|CBM13|GH17	2.49e-23	20	301	15	272
AIG55518.1|CBM13|GH17	1.07e-22	28	301	21	270
CCA14249.1|GH17	7.64e-22	28	300	94	374
UIZ21797.1|GH17	8.64e-22	28	300	574	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.96e-08	28	300	39	289	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBG6|BTGE_NEOFI	2.35e-08	25	277	304	530	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	7.56e-08	25	277	317	543	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	7.56e-08	25	277	317	543	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|A1C499|BTGE_ASPCL	1.35e-06	41	242	325	512	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q04951|SCW10_YEAST	1.46e-06	28	242	138	337	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999757	CS pos: 23-24. Pr: 0.9683

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_96042T0-p1.