CAZyme Information: PHYCI_94356T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_94356T0-p1
• CAZy Family: GT66
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656		74796.32	9.6612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0067:169141-171111(-)

Full Sequence      

MAYPAMCQRRWLLRVLLLVGVVYGSAMLLWYNSRVSDLGLTPTLADDSRTFRPRFGEVEV
VPVTRKPLLERKKQRPRLILSPQGRAAIRKREDELKANSTTVTQTVDHRNETLTRIKTED
PGIVQVRVAQEKWEEAEKHAKTVKNFPRGETNPRKLRCVGWKATGDCSPNGPRVPEKDHS
CTTRVSSGVSGYCEVEDTESGERFRVGRRFCNSLKQESVFRCSDAVGFANFPAQASAAVR
KALQPGFSLPNVGESSSDPRDGIVMVIYPKLMASAYATIRVLRDQGCKLPLELWFIPREM
RNHPADMKTLQELARADGMGDISFHEVSDFHATGFRVKVHAIYNSHFDRLLFLDADNVPV
RDPAFLFDLRGFKETGAVFWPDFWHPSNSIFNIHSQSLIWELLDIPFANMFEQESGQLLI
DRRKHAARLELVRHYAFQRSDILDRMKLVHGDKDLFRLAWLKQLSPFSMIRYPPAVAGKV
INESFCGMTMVQHDTEGNVLFLHRNSNKLTGIARRGDSDNMAEAVRRATAKLASKNPEGR
KTPKFKEVQAELKEIEKIPGKTIEAPELDGYPDPVIWTHLLSFKNTSRRSNYIIETYNAD
PEFSKEQNCYGQRELGKNPNFYVQKFTNLSFSGLETEIRRYATEAASRRQNTLSNP

Enzyme Prediction     

No EC number prediction in PHYCI_94356T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	261	494	1.4e-46	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	5.27e-35	261	494	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	3.43e-05	346	392	89	143	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	3.43e-111	265	645	1	354
CCA25989.1|GT71	1.39e-94	152	515	92	466
UIZ28362.1|GT71	1.32e-90	156	511	666	1026
UIZ24059.1|GT71	1.19e-87	151	646	136	596
UIZ24000.1|GT71	2.42e-87	156	645	104	567

PDB Hits     

PHYCI_94356T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38069|MNN2_YEAST	1.20e-13	262	494	172	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|A6ZQE9|MNN5_YEAS7	2.53e-12	247	496	137	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	3.34e-12	247	496	137	435	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	4.28e-10	261	470	293	532	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q59WF4|MNN2_CANAL	3.83e-07	275	384	201	312	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000082

TMHMM  Annotations     

Start	End
12	31