CAZyme Information: PHYCI_90388T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_90388T0-p1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		63052.21	6.6181

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0010:142261-143955(-)

Full Sequence      

MAFVTAKYASLTPRIDTVYAILTVNGQSTASGFTATDSRFVLTLNNGQTWALYFSSEVTL
QLGGFSTFVSSSSFSGTIRVAMVPNPDKRSVFDETAGCILEGGNVEAQDVNTYAYVWKSS
GSCTEPSGLLHYAQIHHVDTLDRSTAVEVEGVVAYSTTRGPMQALITTTASPMWRFMDTT
DIPISFYPSRAPSPSDVEQYRIKETLIKDIGSTWKIHVSGSYYFNGKAAQKYASLCLMAA
DPSVVGTGFDSKNLLHRCLTKLKALLAPFLTNSWKYTLKYDTVYRGILSSQGFALNDVNA
DFGNTMYNDHHYHYGYWIVTAAIVNKLDPTWSGIAELNRMTSFLVRDVANPSWDDPYFTK
FRSFDWFRGHSYSHGVLSFADGKDQESSSEDMNFHYGVALFGQVTGDEELATIGRLMVKI
NARAIQTYFLLTDANRAQPAMFRPNKVTGILFDNKVNYATWFSPEKFAIHGIQMIPISPV
TEFVRTHEFVSEEWDQVLSSIPDIVNDNLRNPWLSLLYVNYATINKTLALTKLERTRMDD
GLSRSWALYMAAVSSAQPFTTHKV

Enzyme Prediction     

No EC number prediction in PHYCI_90388T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	1	549	1.9e-157	0.819935691318328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.36e-149	220	548	29	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	8.18e-124	1	558	201	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.37e-29	1	188	127	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	6.05e-251	1	552	239	790
UIZ20868.1|GH81	1.21e-209	1	552	236	790
UIZ20872.1|GH81	2.44e-209	1	552	236	790
UIZ20875.1|GH81	2.44e-209	1	552	236	790
UIZ20873.1|GH81	4.88e-209	1	552	236	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.25e-105	1	552	161	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.22e-105	1	552	186	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	5.90e-102	2	552	162	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.75e-24	308	529	414	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.86e-22	187	542	325	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	6.85e-91	1	558	149	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.73e-86	1	552	346	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.89e-86	1	552	191	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	7.66e-75	1	548	547	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	8.98e-73	1	554	223	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999880	0.000168

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_90388T0-p1.