CAZyme Information: PHYCI_89496T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_89496T0-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	PcinCBS144-22_SC0004|CGC4	26381.24	4.4868

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0004:509131-509856(-)

Full Sequence      

MKLSSAVLALTAAASAVNAQEFCGRNDLKVVSDYTVYNNLWGEDNDPQGGQCTTVDGSSG
SEISWHTHFNWAGDNWQVKSYANAALKFDPVQVANVKSIPTTMSYNYTYDGNIITNVAYD
LFTSPTIGGDTAYELMVWLAALGGAWPLTVTGQPIKSVNLGGVDFNLYQGWNNKTKVFTY
VAKQTTYTFSADLRQFFDELPADNTIETTQYLTHVQAGTEPFQGKNATFTVYKYSAAVNT
A

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	90	238	5.7e-41	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	8.33e-43	34	239	3	207	Glycosyl hydrolase family 12.
235746	PRK06215	1.30e-13	34	218	52	211	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAT66504.1|GH12	8.65e-164	1	241	1	241
EGZ11358.1|GH12	8.65e-164	1	241	1	241
ABB22033.1|GH12	9.03e-148	1	240	1	241
ABB22034.1|GH12	7.04e-115	1	241	1	242
ABB22024.1|GH12	1.88e-114	3	238	4	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	2.89e-69	18	238	23	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VL8_A	7.94e-66	14	238	6	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	1.28e-65	21	238	6	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
6K9D_A	1.43e-44	34	239	15	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
5M2D_A	3.27e-44	10	239	6	235	CRYSTAL STRUCTURE 4Ac Endoglucanase-like protein from Acremonium chrysogenum [Acremonium chrysogenum ATCC 11550],5M2D_B CRYSTAL STRUCTURE 4Ac Endoglucanase-like protein from Acremonium chrysogenum [Acremonium chrysogenum ATCC 11550]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	2.31e-79	1	239	1	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	1.38e-75	17	239	16	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|B0XNQ1|XGEA_ASPFC	5.94e-72	1	238	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xgeA PE=3 SV=1
sp|Q4WJU8|XGEA_ASPFU	1.69e-71	1	238	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xgeA PE=3 SV=1
sp|A1D4F1|XGEA_NEOFI	2.40e-71	1	238	1	237	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999765	CS pos: 19-20. Pr: 0.9661

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_89496T0-p1.