CAZyme Information: PHYCI_89406T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_89406T0-p1
• CAZy Family: GT31
• CAZyme Description: Mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	PcinCBS144-22_SC0003|CGC1	48044.49	9.4443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0003:901174-903056(+)

Full Sequence      

MSRRTVALFGGALALRLALLLYGHVQDQLMAVKYTDVDYDVYSDAAREVAEGNSPFERTT
YRYTPVLAFMLLPNVYVHHEFGKLLFVACDLLVGYVLYQILRLRGLTDKNAVNYCCVWLF
HPFSVNISTRGNADSIVVLLVMLSLLLVMRKQIVLSALAYGAAVHFKIYPIIYALAFLVF
LDGDFRISNGKWTSSCGSSACVWIKLAGQLNRDRLGFGVVSGGLFLLLAGGFYYLYGFQF
LYEAYLYHFTRTDNRHNFSVYFYDLYLRYNTPSGFGVGLLAFLPQLTSLVAVSFAYGRDL
PFALFGLTMVFVIFNKVCTAQYFLWYTAFLPLIFPLTSLRLKWKGLAMIAAWLGGELHWL
YWAYHLEMQGSNTFSPLWVAGLLFFSVNVTILAMLMRNHSFTPLFKRGKIVQLFPNDRAK
LQ

Enzyme Prediction     

No EC number prediction in PHYCI_89406T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	395	4.3e-92	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.49e-133	22	411	25	430	GPI mannosyltransferase
252941	Mannosyl_trans	4.89e-72	127	396	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	3.54e-153	16	410	16	407
BBN20063.1|GT50	1.32e-118	2	408	33	440
VDC86084.1|GT50	9.65e-117	1	407	15	424
CAG7892072.1|GT50	9.65e-117	1	407	15	424
VDD20265.1|GT50	1.24e-116	7	407	5	410

PDB Hits     

PHYCI_89406T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9H3S5|PIGM_HUMAN	2.01e-115	9	409	22	421	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	2.01e-115	9	409	22	421	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q500W7|PIGM_ARATH	6.67e-115	1	407	16	436	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	2.59e-113	9	409	22	421	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1
sp|Q5EA10|PIGM_BOVIN	4.72e-111	16	409	29	421	GPI mannosyltransferase 1 OS=Bos taurus OX=9913 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998824	0.001189

TMHMM  Annotations     

Start	End
345	362
374	396
7	26
84	106
127	149
159	181
215	237
274	296
303	325