CAZyme Information: PHYCI_89339T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_89339T0-p1
• CAZy Family: PL4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		35147.76	6.5711

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0003:580465-581400(+)

Full Sequence      

MAELSVTRDLVGYGACGLDPKWPGGKKLALQFVLNYEEGGENCLLNGDAASEHLLSDIVG
AAPYVGQRHMNMESLYEYGSRAGFWRLHRAFTERQLPLTVYAVGLALEQNPEAARAMKDA
GWEVASHGYRWIDYQNVDEATEREHIRKTVAIHEKLLGARPVGIYQGKPNVNTRRLVVEE
GGFLYDADAYNDDLPYWNTQFGRPHLVIPYTLNNNDMKFVSAQGFNSGDQFFTYLKDAFD
VLLAEGRAGQPKMMSVGLHCRVVGHPGRIAALLRFLDYVQSFQDVWICKREEIARHWYKT
HYPQDAAASKL

Enzyme Prediction     

EC	3.5.1.41:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211797	uraD_N-term-dom	0.0	8	301	3	295	putative urate catabolism protein. This model represents a protein that is predominantly found just upstream of the UraD protein (OHCU decarboxylase) and in a number of instances as a N-terminal fusion with it. UraD itself catalyzes the last step in the catabolism of urate to allantoate. The function of this protein is presently unknown. It shows homology with the pfam01522 polysaccharide deacetylase domain family.
200599	CE4_PuuE_SpCDA1	8.37e-179	22	296	1	273	Catalytic domain of bacterial PuuE allantoinases, Schizosaccharomyces pombe chitin deacetylase 1 (SpCDA1), and similar proteins. Allantoinase (EC 3.5.2.5) can hydrolyze allantoin((2,5-dioxoimidazolidin-4-yl)urea), one of the most important nitrogen carrier for some plants, soil animals, and microorganisms, to allantoate. DAL1 gene from Saccharomyces cerevisiae encodes an allantoinase. However, some organisms possess allantoinase activity but lack DAL1 allantoinase. In those organisms, a defective allantoinase gene, named puuE (purine utilization E), encodes an allantoinase that specifically catalyzes the hydrolysis of (S)-allantoin into allantoic acid. PuuE allantoinase is related to polysaccharide deacetylase (DCA), one member of the carbohydrate esterase 4 (CE4) superfamily, that removes N-linked or O-linked acetyl groups of cell wall polysaccharides, and lacks sequence similarity with the known DAL1 allantoinase that belongs to the amidohydrolase superfamily. PuuE allantoinase functions as a homotetramer. Its monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of DCAs. It appears to be metal-independent and acts on a small substrate molecule, which is distinct from the common features of DCAs that are normally metal ion dependent and recognize multimeric substrates. This family also includes a chitin deacetylase 1 (SpCDA1) encoded by the Schizosaccharomyces pombe cda1 gene. Although the general function of chitin deacetylase (CDA) is the synthesis of chitosan from chitin, a polymer of N-acetyl glucosamine, to build up the proper ascospore wall, the actual function of SpCDA1 might involve allantoin hydrolysis. It is likely orthologous to PuuE allantoinase, whereas it is more distantly related to the CDAs found in other fungi, such as Saccharomyces cerevisiae and Mucor rouxii. Those CDAs are similar with rizobial NodB protein and are not included in this family.
200602	CE4_SpCDA1	7.58e-114	22	301	1	295	Putative catalytic domain of Schizosaccharomyces pombe chitin deacetylase 1 (SpCDA1), and similar proteins. This family is represented by Schizosaccharomyces pombe chitin deacetylase 1 (SpCDA1), encoded by the cda1 gene. The general function of chitin deacetylase (CDA) is the synthesis of chitosan from chitin, a polymer of N-acetyl glucosamine, to build up the proper ascospore wall. The actual function of SpCDA1 might be involved in allantoin hydrolysis. It is likely an ortholog to bacterial PuuE allantoinase, whereas it is more distantly related to the CDAs found in other fungi, such as Saccharomyces cerevisiae and Mucor rouxii. Those CDAs are similar with rizobial NodB protein and are not included in this family.
213021	CE4_PuuE_HpPgdA_like	9.07e-68	29	296	1	247	Catalytic domain of bacterial PuuE allantoinases, Helicobacter pylori peptidoglycan deacetylase (HpPgdA), and similar proteins. This family is a member of the very large and functionally diverse carbohydrate esterase 4 (CE4) superfamily. It contains bacterial PuuE (purine utilization E) allantoinases, a peptidoglycan deacetylase from Helicobacter pylori (HpPgdA), Escherichia coli ArnD, and many uncharacterized homologs from all three kingdoms of life. PuuE allantoinase appears to be metal-independent and specifically catalyzes the hydrolysis of (S)-allantoin into allantoic acid. Different from PuuE allantoinase, HpPgdA has the ability to bind a metal ion at the active site and is responsible for a peptidoglycan modification that counteracts the host immune response. Both PuuE allantoinase and HpPgdA function as a homotetramer. The monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of polysaccharide deacetylase (DCA)-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. However, in contrast with the typical DCAs, PuuE allantoinase and HpPgdA might not exhibit a solvent-accessible polysaccharide binding groove and only recognize a small substrate molecule. ArnD catalyzes the deformylation of 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol to 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol.
200600	CE4_Sll1306_like	3.63e-51	22	295	2	265	Putative catalytic domain of Synechocystis sp. Sll1306 protein and other bacterial homologs. The family contains Synechocystis sp. Sll1306 protein and uncharacterized bacterial polysaccharide deacetylases. Although their biological function remains unknown, they show very high sequence homology to the catalytic domain of bacterial PuuE (purine utilization E) allantoinases. PuuE allantoinase specifically catalyzes the hydrolysis of (S)-allantoin into allantoic acid. It functions as a homotetramer. Its monomer is composed of a 7-stranded barrel with detectable sequence similarity to the 6-stranded barrel NodB homology domain of polysaccharide deacetylase-like proteins in the CE4 superfamily, which removes N-linked or O-linked acetyl groups from cell wall polysaccharides. PuuE allantoinase appears to be metal-independent and acts on a small substrate molecule, which is distinct from the common feature of polysaccharide deacetylases that are normally metal ion dependent and recognize multimeric substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29843.1|CE4	1.86e-208	6	311	2	307
BAU40525.1|CE4	8.27e-163	5	303	4	301
QKD84160.1|CE4	2.37e-162	8	303	7	301
QEP08414.1|CE4	4.74e-156	7	303	10	307
QKV18789.1|CE4	6.18e-154	8	305	9	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CL6_A	1.42e-132	3	308	2	307	Crystal structure of Puue Allantoinase [Pseudomonas fluorescens],3CL6_B Crystal structure of Puue Allantoinase [Pseudomonas fluorescens],3CL7_A Crystal structure of Puue Allantoinase in complex with Hydantoin [Pseudomonas fluorescens],3CL7_B Crystal structure of Puue Allantoinase in complex with Hydantoin [Pseudomonas fluorescens],3CL8_A Crystal structure of Puue Allantoinase complexed with ACA [Pseudomonas fluorescens],3CL8_B Crystal structure of Puue Allantoinase complexed with ACA [Pseudomonas fluorescens]
1Z7A_A	1.27e-128	8	308	7	308	Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_B Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_C Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_D Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_E Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_F Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_G Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1],1Z7A_H Crystal structure of probable Polysaccharide deacetylase from Pseudomonas aeruginosa PAO1 [Pseudomonas aeruginosa PAO1]
3S6O_A	9.48e-122	8	303	13	310	Crystal structure of a Polysaccharide deacetylase family protein from Burkholderia pseudomallei [Burkholderia pseudomallei],3S6O_B Crystal structure of a Polysaccharide deacetylase family protein from Burkholderia pseudomallei [Burkholderia pseudomallei],3S6O_C Crystal structure of a Polysaccharide deacetylase family protein from Burkholderia pseudomallei [Burkholderia pseudomallei],3S6O_D Crystal structure of a Polysaccharide deacetylase family protein from Burkholderia pseudomallei [Burkholderia pseudomallei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13842|CDA1_SCHPO	1.28e-85	7	301	4	316	Putative polysaccharide deacetylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cda1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_89339T0-p1.