CAZyme Information: PHYCI_87406T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_87406T0-p1
• CAZy Family: GT30
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
685		76446.77	6.4640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0254:59326-61383(-)

Full Sequence      

MSTPPEQDVLSIKDGHFVDQHGRVALLRGVNLGGSSKLPFGYGHTDDQDTSAFFDGAASV
SFVGRPFPLEEADLHLSRLQRWGLTFLRFIVTWEAIEHAGPGQIDHEYLQYIRAVVDKAA
EYNMQVYIDPHQDVWSRWTGGDGAPMWTLECIGFEPRNFEPTKAALCLETCGLPASKFPK
MIWPTNYTKLACATMFTLFWAGKRYAPNCYVDGVQIQEYLQSHYLDSMVALAQALKGLTN
VVGFGTMNEPSSGFIGVKDLAKPIGMFQNGYAPTGIQGMALGEGVAQDVDYWNPGIMSLV
RGKPSRLETVDPKGVRAWKEGYGCVWKEAGVWGFDAESKPQLLKPDYFAGVDFGKEFYLP
FAKQFTRKLQSVFPNAMIFVEMPPVDFGDMEFPEITSEDIPNAVNAMHWYDAITLVTTTW
RSYFTVDFTTGKPAFGNKALRKLHKQQLAHVASFGRKKMGNAPTLIGETGIPYNMNDARA
YISGDYSAQIEAMDNTISNLESQLLSYTLWNYTADNSHEFGDLWNLEDLSINSPDSEQLA
IRLAGGHTRRRDDPARGLKGFARPHARKITGTPLKSEFTMATAEYILEYVSVNTEVTAPT
EIYVPYVHYPGGYRVTSSDGHCTIEKRESYDIVKYVHDVNAHKHRVIISPRTPVGSDSKR
ANAPLYLALAVTAVAVPLLTLYKRR

Enzyme Prediction     

No EC number prediction in PHYCI_87406T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	19	518	3e-181	0.9981447124304267

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408348	Glyco_hydro_5_C	1.10e-20	563	648	1	86	Glycoside hydrolase family 5 C-terminal domain. This is the C-terminal domain of endo-glycoceramidase II (EGC), a membrane-associated family 5 glycosidase pfam00150. The C-terminal domain assumes a beta-sandwich fold, which resembles that of many carbohydrate-binding modules.
395098	Cellulase	8.53e-05	64	133	20	88	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27469.1|GH5_12	1.47e-268	2	682	6	706
CCA13966.1|GH5_12	7.49e-233	10	653	51	735
AIG56220.1|GH5_12	5.10e-223	10	676	43	684
BAJ64239.1|GH5_12	3.48e-178	10	615	1	591
QPC82820.1|GH5_12	4.68e-167	17	653	11	632

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	6.10e-118	16	618	27	725	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
5CCU_A	8.25e-10	2	253	34	226	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	8.25e-10	2	253	34	226	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1BTD7|EGCR1_RHIO9	5.24e-128	17	653	22	662	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|H1AE13|EGCR1_ASPFM	4.51e-122	17	539	13	569	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|P40566|EGH1_YEAST	5.34e-117	14	658	10	753	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	4.16e-95	10	605	16	635	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	5.11e-08	16	253	42	218	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
663	682