CAZyme Information: PHYCI_76383T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_76383T0-p1
• CAZy Family: GT105
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1092		119276.97	4.9557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0004:245363-248749(-)

Full Sequence      

MTTARGLSTLLLLLWSCARCAWAVPGAELTLQLPFPVASHPLQLSSSLFAASERLPLDAR
LLADVPFPTGAWWTNLVLAEGQSPVASLPYVHRVLDEKLHVSFPFRVVAPREIVEGFISQ
MVVSSRAAQATAATAATPVAHHVVNFDAFSTTLRFSRGQTEEFRVYLVRGSPYVTMEYAH
SRPVLEAMDGLQITRFKKLEGLTLMSGQAAPFATFAAELNNGQTWYLYASDAQLKLRLDA
NGQVTSDEPFTGVLRVALCLNAKVMPYLLESAPVYAVGGDVAHSVHPDDADKALLQFRWK
TKSFSTFHGEAEQVSEKENNKLLMVALPHHMDVMQVQKSGQVLEKGKNKVLSDLRYTSIR
GLMEGVYGAVWHMTETLPSVEWNYADDGLFSDDFSGTLEDGNEFRADDQQLRLDMREKAK
QAILKQLPLDVDTYPLPLSPDSYNFGKQVGRDARLLLIADKFSQEEVKQKLLAKVEMEIV
EWLEATNANHFVYDQTFGGVITNDGWHDKEADYGNGYYNDHHFHYGYFIYALAAIRKFDP
AFIEKHAQACALLMGDIGTPLLDSNTTFFNDLPVRLLFPTARHKDWFVGHSYASGLFPME
VGKSQESSSEDLNAYYALALFSSLDEKATEGQGDSSYHQYARLLLATELRSVKKYWHMAE
NSKIYEPVFSKNAMVGVVGETNVVYNTWFGDRAVYIHGINMLPFTPFTPHLLDEEYVARE
YALLSQDLPDLGQYDIWRSIVVMDHAILNAADAWDELNNTVKAFDTWSSRTNAMHWIATR
PSWFAQKNRPALSNPDLDADDKCFGFPACASAGENGTALMCCGTLPGCCPSNLGCCPQED
PALLPSNACFGEHECAVLGLGCCNTIDGCCEPDPISGTVLGCCKNQHPVISNTTHKAVHA
AKDSAVCYGEPLCAAAKLDCCGAPGGCCAGSGVKLDCCSSEATVSGSSSPSHSSNANTCQ
GQPKCGAAGLDCCGWDGGCCKPDPVTGAKLDCCQDEASDEPSTEAIPIRNGNGHHEDHDS
DDSAAGEGLGDTVTRIFIGLGGAVLFIAVVYAVGLCYRRRGYASIDGDMRAIYCAGMMVG
VIGFFIFLIVTS

Enzyme Prediction     

No EC number prediction in PHYCI_76383T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	64	776	2e-154	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.19e-77	417	771	4	346	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.32e-75	66	777	89	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.03e-48	64	385	12	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	0.0	11	1092	8	1080
CCA18874.1|GH81	2.52e-233	30	895	5	855
AUX36386.1|GH81	6.64e-107	35	781	71	713
AGP40408.1|GH81	5.03e-106	35	781	60	702
CAN97272.1|GH81	2.04e-105	39	781	66	718

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.90e-49	24	793	10	731	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.41e-49	24	793	35	756	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.11e-46	24	793	10	731	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	9.85e-30	66	777	48	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	1.09e-29	66	777	68	709	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.81e-40	167	755	145	674	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.75e-38	153	754	328	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.23e-35	143	778	550	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.26e-34	64	774	431	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.88e-34	443	760	413	714	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999760	CS pos: 23-24. Pr: 0.9728

TMHMM  Annotations     

Start	End
1036	1058
1071	1090