CAZyme Information: PHYCI_7631T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_7631T0-p1
• CAZy Family: GT10
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309		32251.16	6.7705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0044:142656-143584(-)

Full Sequence      

MVRRLLGAVLAVVLAHHGLAGAASISTGTAPGFAVGTTGGGNAKPVYPTSIKELTTYLSD
AEPRVIVLDQEFKFVNTEGSTTEGGCRPTNNQQCLAKNNGFKGQDAILMDGDTNMKQTGG
CDSGGISVDVTYDNAAKEPLTVASDKTLVGEGTKGVLNGKGLLITGSNVIVQNIHITNLN
PHLVWGGDAITIRGEGDVAPKGIWIDHVKVSSIGRQMVVINFSGATGVTISNSDFDGNTK
FSASCDGHHYWGFLILGKKTELSLIGNYIHHTSGRSPKIGGHNGETSVVHAANNYFFENS
GHAFDVATG

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	130	308	1.5e-76	0.9197860962566845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.71e-31	129	309	1	176	Amb_all domain.
226384	PelB	2.74e-12	18	309	33	261	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	2.23e-07	123	308	13	200	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19253.2|PL1_4	4.12e-195	1	309	1	309
ACR19257.1|PL1_4	8.29e-155	24	301	19	296
ACR19256.1|PL1_4	2.53e-153	5	309	11	306
ACR19250.1|PL1_4	1.42e-143	28	309	194	466
ACR19254.1|PL1_4	8.42e-120	23	305	20	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	4.67e-76	28	309	5	266	Pectin Lyase B [Aspergillus niger]
1IDJ_A	1.49e-71	27	309	4	266	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	1.18e-70	27	309	4	266	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	7.28e-86	32	306	29	283	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	8.57e-84	28	309	25	287	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	8.57e-84	28	309	25	287	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|A2R6A1|PELF_ASPNC	1.81e-82	27	306	25	285	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.81e-82	27	306	25	285	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999585	CS pos: 22-23. Pr: 0.9697

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_7631T0-p1.