CAZyme Information: PHYCI_60959T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_60959T0-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1100	PcinCBS144-22_SC0002|CGC3	119589.00	4.6278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0002:612110-616771(-)

Full Sequence      

MLVARHSILLLLLLPQAAASALLVSSLLHATAATINDDIAQVATDGDHPRYLDPFSTDVP
SETLFQRQGGLKTLAPIINVADELLDKPIPTNKWWGNLIHTTTEDINTVANPAWSNPYAL
KLPKQAPFGLQACYSYTYRQLADEVDGVVRYYLHEFHNDVTLSASEFGSTKPDYEVYSFS
DTGVALRTCVAGGGGSGRLSCMDSALVHGMAFVSATYAGLTPRIESDYAMTLLDSSTPGK
YVVQLANKQKWVVFASDTSATFSVDSTGSALAAAAGYTGTVRVAVLPESGEQDVYDDYAS
CVVRGGDVSVQSRTSYSLEWETEGSGCDSSGLLHFALPHQVEVMDDATTMQSSGAIVLHS
STRGQMVGQVTKSGRWTLSEPEADDEVDFYPANKPAAAVISQIGLLSTLQGDIDSTWTLD
TGSWYFSGKAYQKYASLCLMATDSTVVGTSTALRRRCLSKLEALIEPFLTNSLSAPLVYE
TTYKGVVSNLAFTTGDINVDFGNGVYNDHHYHYGYWVTASAILKKLDPTWSGMAQLDIMV
WTLLRDVANPSSDDTYFPKFRHFSWYLGHSYSHGVTPMADGKDQESTSEDVNFYYGMMLW
GKVTQNQAVEDLGSLMLRLNARAVRTYFLMTSDNAIHPPQFVPNHVTELCYPDRRTPTET
KFFKERLRKSIQFVDALLCKPPSGKVCGRGCKKIRAQMCSSSTPCKNKMCRIWHDVEAHT
DRCQNPQCEFKNRILLRETMHKLDMKEQQISAAKADLVGKQVQLKEADDDDKEALENEIA
SLEQDLEEFDGELGVLETTKKTFWDNLNEIGIEVSDDVVDNFPDFATHYETKKAPRQARK
ATAVPTANLSSASSRGSRAAARRASSGPHGGGAGNEEDEEDADAESMGNNIPRRTARRST
SSGRHTASPQNESDEETKGGDEEAKEGGAETYRSGRVIPRPDEPPLPPAGPPPFRQNPEL
DRAYAAAASGYSIHPPADDLEASAVAMDLETPVVAIVGDQETPTVATAPELTKQAQVTSE
NEISELQNLADAQQASDEISGIMADFSANPPPVDPANTAGFSSNPTAVDPANTTGFSSNP
PVDPVNTTGFTIRGNQPQNP

Enzyme Prediction     

No EC number prediction in PHYCI_60959T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	80	653	3.8e-144	0.8247588424437299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.15e-103	393	647	3	248	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.56e-99	76	647	78	648	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.49e-54	86	391	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	51	686	44	670
UIZ26440.1|GH81	0.0	51	686	44	670
UIZ26131.1|GH81	1.37e-256	51	654	12	615
UIZ26137.1|GH81	4.23e-252	51	654	122	725
UIZ26602.1|GH81	4.23e-252	51	654	122	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.36e-72	87	662	39	629	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.61e-72	87	662	64	654	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.85e-69	87	662	39	629	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.86e-24	85	628	31	535	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.22e-17	507	647	439	577	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.73e-71	88	654	34	602	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	8.76e-67	88	654	225	798	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.02e-64	80	688	73	668	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	1.20e-58	87	654	459	1038	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.73e-57	76	654	99	678	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.023437	0.976533	CS pos: 19-20. Pr: 0.8760

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_60959T0-p1.