CAZyme Information: PHYCI_588451T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_588451T0-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	PcinCBS144-22_SC0008|CGC4	22535.84	4.2553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0008:787519-788165(-)

Full Sequence      

MAKTFAAVVAACAVASTSAASVPDGTWPTSAGTVQYTEPYTVKAGEVFDGGLKTYERSDI
SCEGQTESGSSTAVFLVEAGGTLKNVIIGADQMEGVHCDDHDCTIENAWWDDVCEDALSI
KGRSASSVSTVTGGGARNADDKVIQHNGYGTVKIDGFYVDTFGKLYRSCGTCGNEPRKVT
VSNVLVVNPSVSLVTVNENYGDEATLSNIYIKSSD

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	31	213	1.4e-80	0.9381443298969072

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	7.56e-95	25	209	2	181	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	2.93e-108	1	214	1	213
ADN18837.1|PL3_2	1.96e-100	19	212	28	221
ADN18840.1|PL3_2	1.91e-93	19	212	28	221
ADN18838.1|PL3_2	2.34e-91	1	163	1	165
ADN18839.1|PL3_2	7.29e-87	20	212	21	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	1.66e-26	54	213	8	182	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	1.44e-25	54	213	126	300	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	5.00e-25	38	170	7	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.29e-19	32	181	6	146	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.32e-19	32	181	7	147	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ20|PLYG_ASPTN	1.40e-65	28	206	28	201	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	7.68e-64	28	206	43	218	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q5AY82|PLYG_EMENI	3.26e-61	28	206	39	212	Probable pectate lyase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyG PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	1.18e-60	28	206	23	197	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	1.18e-60	28	206	23	197	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999774	CS pos: 19-20. Pr: 0.9824

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_588451T0-p1.