CAZyme Information: PHYCI_576719T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_576719T0-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	PcinCBS144-22_SC0004|CGC3	25862.76	4.2592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0004:453346-454099(-)

Full Sequence      

MKISAIFAASAVAVAASPALAEEEFCGQWNLTRTDDYIVYNDLWGFFADPTGTHARVSTV
STDPPSLSTRASAGQAPRRKSSLDHLPISDVTSIPSTIQFKYDYDGGLIANVAYDLFTSS
TADGDAEYEIMVWLATIGGAGPLSNTGSAVAQVAVGGVDFELYHGKNGNITVYSFVAPTI
VNSYSTDLKQFFDNLPANLTIAPTQYLINVQAGTEPFVGNGTLTVSKYSAAVKTAEYSQI
QQQ

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	87	232	1.9e-39	0.9743589743589743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	7.74e-36	37	232	3	206	Glycosyl hydrolase family 12.
235746	PRK06215	6.11e-13	26	189	41	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22027.1|GH12	3.83e-117	1	243	1	251
ABB22026.1|GH12	1.28e-102	1	235	1	243
ABB22034.1|GH12	1.16e-80	1	235	1	242
ABG91065.1|GH12	4.54e-78	1	234	1	243
ABB22025.1|GH12	1.59e-73	1	235	1	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	1.68e-50	24	233	6	222	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	2.06e-50	24	233	13	229	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	1.96e-48	24	232	26	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
5GM3_A	1.24e-33	24	233	2	219	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
5GM5_A	7.04e-33	22	233	1	220	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus],5GM5_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus],5GM5_C Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus],5GM5_D Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus],5GM5_E Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus],5GM5_F Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus],5GM5_G Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellobiose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W2PDG1|XLP1_PHYPN	5.82e-57	11	232	7	237	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	3.28e-54	7	232	4	240	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	4.37e-54	1	232	1	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|Q0CRC9|XGEA_ASPTN	3.85e-52	24	232	32	249	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|W2PEP3|XEG1_PHYPN	3.34e-51	9	232	6	240	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999781	CS pos: 21-22. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_576719T0-p1.