CAZyme Information: PHYCI_557452T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_557452T0-p1
• CAZy Family: GH72
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		39192.54	9.9781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0137:117508-118698(-)

Full Sequence      

MKFFTTALAVFALLATTANGSPMLRMEAEGKKGKSKTEAPVTSSGCHLTGTYKKGTNIAS
CSSIIVDSMTVPAGVTLDLSKAKKGAVIEFKGTTTFGTLKWAGPLVLVGGADLTVTGSGT
LDGQGSWYWKQGQSITRPVFFRLQNVISSTVSKFTIKNMPFRTFSIVTSKDTTLTGLTID
NRAGNGIAKNTDGFGLTKNDHITITGNIIYNQDDCLAMQSSTNTFFTNNRCYGSHGISVG
SLGGNTVDQSTTVQGLTVEGNIIVDSDNGLRIKTIIGLKGLVSDVKYVDNELSNVKNAIV
IRSDYSKAKGGYTGAATSQVTIKGVTVSGLTGTATNLYDIMTNPKAVSNWSFSGIDVSTS
AKGKLAGAPNSMSV

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	58	363	1.9e-60	0.9353846153846154

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.83e-71	61	362	1	308	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.35e-23	30	343	74	391	polygalacturonase ADPG
215426	PLN02793	6.61e-22	49	334	69	368	Probable polygalacturonase
227721	Pgu1	1.55e-21	101	304	188	407	Polygalacturonase [Carbohydrate transport and metabolism].
215540	PLN03010	1.42e-20	66	364	80	381	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKP15054.1|GH28	7.25e-224	1	374	1	380
UKP15055.1|GH28	3.64e-220	1	374	1	402
AAN05466.1|GH28	1.54e-217	1	374	1	414
UKP15058.1|GH28	2.19e-217	1	374	1	414
AAN05467.1|GH28	1.14e-212	1	374	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KVE_A	1.92e-61	46	362	11	331	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.92e-61	46	362	11	331	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	4.71e-60	46	362	3	323	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1NHC_A	6.64e-60	44	358	1	319	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
2IQ7_A	1.01e-59	59	362	16	324	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UHL4|PGLR1_ASPOR	3.38e-68	11	362	3	354	Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgaI PE=1 SV=1
sp|P41750|PGLRB_ASPFA	3.38e-68	11	362	3	354	Endopolygalacturonase B OS=Aspergillus flavus (strain ATCC MYA-384 / AF70) OX=1392242 GN=pgaB PE=2 SV=2
sp|B8N8M2|PGLR1_ASPFN	3.38e-68	11	362	3	354	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1
sp|P26215|PGLR_COCCA	6.82e-67	45	362	29	351	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|Q0CMU3|PGLR1_ASPTN	3.65e-64	11	358	4	351	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999773	CS pos: 20-21. Pr: 0.9834

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_557452T0-p1.