CAZyme Information: PHYCI_32400T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_32400T0-p1
• CAZy Family: GH5
• CAZyme Description: Predicted endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798	PcinCBS144-22_SC0139|CGC2	89716.73	5.2961

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0139:60648-63044(-)

Full Sequence      

MLSSSPRPHHSGEVHPLLDTHAAVPLTQQQQQPTDRRRVSRWSVLAVASTLLFGAAVFGV
FKPSPATLRSVTTVAPDAKFDLFTPIFNAEAPPDSLFNHTDAHKTLLPPQYLAPGLVGSR
PIPTNDWWGNMIGVTVGEENVVHPVWTNPYSVTPSIFMEPYGLTMNYPFTTREFGGGLTG
NGDAEMYYLHGQVPEFTFSATEFSNASHPVFEVFDWDDLSVQLRFMDRRDNSKKFEATLA
SGMAFVTARYSGLTPRFQTVYNISTINGLDSTESINRPLTNDRYVLQFDNGATWTLYFST
QVSLYFDGHSTLDMKQPFTGVSRVALIPDASAQEQKIFDETASCVLDGGSVEAHNENAYA
YKWRTSGDCASNGMLHYAQVHHVDTLDRRYAVEAEGVAAHSTTRGLMQGVVTKTSPPEWR
LVETVDFPIDFYPPRKPEASVVENYEMKKNLIADIDAEWSIALGQSYYFNGKAAQKYASL
CLMAGDASVVSEDDTTLLPRCIKKLEGLLTPFLENLWTNPLNYDTIYRGVVSSQGFTLHD
PNVDFGNTMYNDHHYHYGYWVVTAAIINKLDPTWSGIPALNRMAGFLIRDVANPSDADPY
FPKFRSLDWYRGHSYSHGITALGDGKDEESTSEDMNFYYGMTLLGKVTGDTHLETVGKLM
VKLNARAIQTYFLLEDGNRAHPDRYRDNKVMGILFDNKVNYATWFSGEKYAIHGIQMLPA
TAVTEFVRTREFVSQEWDQILSREPIVQNDEQTNPWLSLLYMNYATVNKEFALEKLRNVT
MDDGLSRSWAMYIAATRP

Enzyme Prediction     

No EC number prediction in PHYCI_32400T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	119	792	5.7e-177	0.9710610932475884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.07e-146	466	791	30	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.36e-137	121	795	89	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.95e-46	119	430	12	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	0.0	1	798	1	793
UIZ20868.1|GH81	2.39e-241	87	796	85	791
UIZ20872.1|GH81	4.78e-241	87	796	85	791
UIZ20875.1|GH81	4.78e-241	87	796	85	791
UIZ20873.1|GH81	9.58e-241	87	796	85	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.03e-115	81	798	7	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.37e-115	66	798	10	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	9.11e-112	81	798	7	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.32e-24	551	788	414	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.55e-22	432	785	325	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.42e-93	121	795	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	7.60e-90	121	791	110	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	6.81e-88	71	795	52	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	1.20e-86	121	795	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.00e-84	109	791	421	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999893	0.000143

TMHMM  Annotations     

Start	End
39	61