CAZyme Information: PHYCI_303369T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_303369T0-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	PcinCBS144-22_SC0012|CGC1	27034.35	8.3305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0012:208085-208834(+)

Full Sequence      

MDRIVFLLCAVLATSASVSSAWPTSKGNVRYNGVKVIKKGETFDGGMKTYQRSDIKCKGQ
SEGGWRDAVFKLEAGAKLKNVIIGPDQREGVHCDDHDCTVENAWWEDVCEDALSVKGGNK
NSVTNVLACGAKNAEDKVIQHNGYGHVNINGFYAENFGKLYRSCGTCGNIKRTVSLNHVW
GYNPKVSLVTVNANNGDVATFTNDIHVHTSKGANAVCQTTTSTNGKEPTVTSKGPSKNCV
FNKDKIEFY

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	26	220	8.7e-75	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	5.73e-86	19	219	1	192	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18836.1|PL3_2	3.51e-167	1	249	1	249
ADN18837.1|PL3_2	5.04e-83	10	248	11	260
ADN18841.1|PL3_2	4.54e-82	5	236	9	239
ADN18840.1|PL3_2	1.16e-81	19	248	33	260
AHX74070.1|PL3_2	3.96e-70	2	203	7	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.28e-24	37	165	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	7.06e-21	36	187	15	178	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	7.21e-21	36	187	16	179	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	6.33e-20	36	187	24	187	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	6.33e-20	36	187	24	187	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1C4B8|PLYE_ASPCL	1.12e-59	23	243	37	249	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	6.03e-59	23	241	43	257	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|A1DBJ7|PLYE_NEOFI	5.07e-58	23	241	37	247	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	1.16e-57	7	247	6	245	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	2.03e-57	23	243	37	249	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000218	0.999764	CS pos: 21-22. Pr: 0.9149

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_303369T0-p1.