CAZyme Information: PHYCI_302624T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_302624T0-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		59512.53	4.6669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0010:624303-628472(-)

Full Sequence      

MGRSQLSVVLASFLALHFSLLCGRGACDVVTYDWRLTPIMTAFDGVLLETLGVNDKPSHE
AVIEVELGQEVEVRVTNELYNATCLHWHGMKQLGTQEMDGPDKAGTFWWHSHHKTHDLRA
CEKEIEQEFTVQLADIYHTAPKFGPALWDTIVINNRGRFNCTDAAINNLTECSNDQPLTT
YDFQAGKKYLLRLINVAAMAPFDFSIDDHEFRVIAADGEPVEPTEPINSIFINAGQRYDI
VLESKNDTQDSFWMRAKGLTGLPWMARSADTGLPGFNDEGLAIVRYDAASTSEPMTTQCE
ETVTVNEFDFKPVVPSVLPTTPSDRSIVQFNITQLGGVISLDGGKYNSLAIPDQPPLLTI
SNGSTTSDLPATANARALEYGKHIEVVVVNSMNEQHPFHLHSHAPWVVGSGQASAEDVYN
NDLPPSKLEGAVLRDADNPGVWMMHCHIEWHMSVGMGMIYVEGEAELQKKGPDAFSSSLL
SVCKPSKDSHSNSTEYSDDNPGQHDSRKYKHAGAVDDTMSNGLRESKEALGEKSPNGCSG
Q

Enzyme Prediction     

No EC number prediction in PHYCI_302624T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	61	456	4.6e-62	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.87e-48	29	463	1	524	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
225043	SufI	4.67e-44	62	457	65	443	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
177843	PLN02191	2.10e-40	44	479	41	563	L-ascorbate oxidase
259868	CuRO_2_LCC_like	1.43e-36	130	286	2	152	Cupredoxin domain 2 of laccase-like multicopper oxidases; including laccase, CueO, spore coat protein A, ascorbate oxidase and similar proteins. Laccase-like multicopper oxidases (MCOs) are able to couple oxidation of substrates with reduction of dioxygen to water. MCOs are capable of oxidizing a vast range of substrates, varying from aromatic compounds to inorganic compounds such as metals. Although the members of this family have diverse functions, majority of them have three cupredoxin domain repeats. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 2 of 3-domain MCOs has lost the ability to bind copper.
215324	PLN02604	1.67e-35	63	463	57	547	oxidoreductase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	2.23e-190	1	494	1	556
UIZ26488.1|AA1	4.50e-178	26	483	13	536
AFY09915.1|AA1	1.03e-143	29	483	21	565
UIZ26495.1|AA1	5.46e-143	29	483	23	561
AIG55536.1|AA1	2.76e-59	28	471	39	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z1X_A	7.60e-52	62	472	35	475	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
3FPX_A	2.11e-49	33	472	7	479	Native fungus laccase from Trametes hirsuta [Trametes hirsuta],3V9C_A Type-2 Cu-depleted fungus laccase from Trametes hirsuta at low dose of ionization radiation [Trametes hirsuta]
3PXL_A	2.92e-49	33	472	7	479	Type-2 Cu-depleted fungus laccase from Trametes hirsuta [Trametes hirsuta]
1KYA_A	2.92e-49	33	472	7	479	Chain A, Laccase [Trametes versicolor],1KYA_B Chain B, Laccase [Trametes versicolor],1KYA_C Chain C, Laccase [Trametes versicolor],1KYA_D Chain D, Laccase [Trametes versicolor]
5LDU_A	4.05e-49	33	472	7	479	Recombinant high-redox potential laccase from Basidiomycete Trametes hirsuta [Trametes hirsuta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99044|LAC1_TRAVI	4.22e-48	33	472	28	500	Laccase-1 OS=Trametes villosa OX=47662 GN=LCC1 PE=1 SV=1
sp|Q99056|LAC5_TRAVI	6.60e-48	68	472	64	507	Laccase-5 OS=Trametes villosa OX=47662 GN=LCC5 PE=3 SV=2
sp|Q12717|LAC5_TRAVE	3.32e-47	68	472	64	507	Laccase-5 OS=Trametes versicolor OX=5325 GN=LCC5 PE=2 SV=1
sp|O59896|LAC1_PYCCI	7.50e-47	3	472	5	498	Laccase OS=Pycnoporus cinnabarinus OX=5643 GN=LCC3-1 PE=1 SV=1
sp|Q01679|LAC1_PHLRA	1.07e-46	68	472	62	500	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000551	0.999439	CS pos: 25-26. Pr: 0.7739

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_302624T0-p1.