CAZyme Information: PHYCI_293579T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_293579T0-p1
• CAZy Family: GH38
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	PcinCBS144-22_SC0255|CGC1	47285.18	6.1875

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0255:50486-52072(-)

Full Sequence      

MAFTFVNASWDGKTHCYLKSAIGAKKSIPGAVSAAVTSPRTSPCSTQVDLTGVSHIHAKI
RRGEARSRAVSLGAWLVAEYWMSWDSYTLWQDIPVDIATQGEYVAMNFLGEDKGAAAFSG
HRQTWVTESDLKEIADTGVLNTVRVPVGYWIARDAVDLPGDEGANFAPGGLKFLDVLIND
WALKHNLAVIVSLHAHQGSQNGYAHSAPVTLGAIDWSTSHTNVNNSLAFATFIADRYKDS
PAFLGLNLMNEPAPPTDRKVLIHYYIDAYNRIRASRNDCIILVSPLVTEQDPSGFDGMIR
APVYENVWNEIHAYFIRGYEDRSEAWILDHLDVFKEHNLQRHTKGNRLFVGQWSMAGPPD
EKGMFQDIGCFHELGRKQLAMFNEEATGGWAFWSWRHSDETFTWSLRTLIRYNDMSFSFE
LS

Enzyme Prediction     

No EC number prediction in PHYCI_293579T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	120	404	1.7e-41	0.9747292418772563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.99e-18	91	414	44	380	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.71e-08	119	395	18	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29723.1|GH5	3.56e-104	58	411	3	356
CCA15900.1|GH5	2.61e-98	55	413	101	450
AAM18484.1|GH5	4.58e-98	56	411	9	364
CCA15861.1|GH5	8.46e-93	60	411	16	368
UIZ29004.1|GH5	3.42e-84	45	410	25	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	8.23e-26	68	409	15	377	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.55e-25	68	409	16	378	Chain A, Hypothetical protein XOG1 [Candida albicans]
1EQP_A	1.97e-25	68	409	10	372	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3N9K_A	2.86e-25	68	409	15	377	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1CZ1_A	3.67e-25	68	409	10	372	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	1.10e-30	68	356	30	300	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q96V64|EXG_BLUGR	5.43e-27	68	314	38	270	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|P29717|EXG1_CANAL	1.64e-24	68	409	54	416	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q12626|EXG_PICAN	2.17e-24	70	410	52	414	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1
sp|Q0CR35|EXGA_ASPTN	4.51e-24	68	410	41	397	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000083	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_293579T0-p1.