CAZyme Information: PHYCI_285846T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_285846T0-p1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	PcinCBS144-22_SC0119|CGC1	45656.53	4.4667

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0119:9377-13853(-)

Full Sequence      

MKNQAAVAGLLSLAGLASAANPSWHDLAITAPRYGRYLTRTASKEPFFWQADTAWELIHR
LNKTSIDFYLKTRAEQGYNVVQTVLVSELDGTTRANFYGDLPFNNSDPTNPNEAYFELVD
WTVDLAASYGILMALVPTWGMYVNGGWHSTTPIFNESNANEWGKFIGERYPGLPKILGGD
SNVLWSWNMSEVQAAYAEDPDQDLPSLMAPIEDTSSVWASMRAGLKESESSQGYESVVLY
HPAGGWIVKPEVTPLAYGHNMLQDEEDRDRVSIDAVQSGHATPDPTNKFTPAIGWDSTKN
YECIAEMRDKFTGPVLDLENHYEGAHDSFDLAKTIWNASHIRTGLYHGVYGGATGFTYGA
NSVWQMYEPRSDLLRDSDYYPAQINQNASGSWRNDIYFEGATQIQYVTK

Enzyme Prediction     

No EC number prediction in PHYCI_285846T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	35	408	4.8e-68	0.7475728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	2.16e-118	35	409	2	315	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	3.55e-146	24	409	28	413
KAF3763706.1|GH140	1.58e-133	14	407	17	414
KNX49908.1|GH140	2.98e-68	26	409	13	403
KAE8313632.1|GH140	8.71e-64	10	409	7	399
KAB8203844.1|GH140	1.82e-62	26	409	26	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.01e-21	24	369	13	315	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	4.68e-19	24	369	13	315	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYCI_285846T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001000	0.998970	CS pos: 19-20. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_285846T0-p1.