CAZyme Information: PHYCI_28146T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_28146T0-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		43427.61	4.3725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0044:213094-214625(-)

Full Sequence      

MADRQGSGGQPTRTRPDHTASTMVKSFALLATSATFLLAAATAASVPDGTWPTSAGSVKL
AEVRIVKAGEVFDGKMQTYERSDVTCGGQKESGWQSAVFKLEPGATLKNVIIGKNQMEGV
HCDQHDCTIENVWWDDVCEDALSIKGGTASSVTTVTGGGARSADDKVIQHNGLGTVKIDG
FYGEDVSKLYRSCGTCGGEGRKVSVSNVYVVNPGNAIVTVNKNWNDQATLSNIWVKSSGD
KVKICQWSQGNANGEPSMLGDGPSPPLCQYSESDVHIDGDVSQSTETGNTASSGSTVQQS
SGDEQTGASTSSSLRGSTQQDTSETAQTSAPTTDSPKQEDDNNNAEQTDASSNSEKKKTT
NDGSSKKESDGNNNEQSDDENTKQDDGDNAKQDDSGDKKKDSDNKKKDDDDN

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	55	250	3.3e-79	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.32e-86	49	254	2	199	Pectate lyase.
411414	MSCRAMM_ClfB	5.04e-04	271	395	604	728	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	8.62e-04	271	395	606	730	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	0.001	271	395	610	734	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
236304	PRK08581	0.001	278	396	62	188	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	2.43e-158	23	308	1	285
ADN18840.1|PL3_2	5.71e-111	43	275	28	258
ADN18837.1|PL3_2	2.64e-109	26	275	9	258
AHX74070.1|PL3_2	5.17e-92	29	277	4	275
ADN18839.1|PL3_2	4.14e-91	29	277	4	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.59e-28	66	194	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	1.25e-22	56	194	6	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.28e-22	56	194	7	139	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B90_A	2.53e-22	78	275	8	223	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4Z03_A	1.05e-21	56	194	15	147	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGV9|PLYD_ASPFU	5.12e-55	52	272	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	5.12e-55	52	272	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	1.18e-54	52	272	28	241	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	1.95e-54	52	272	22	236	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	2.65e-53	52	272	41	255	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008370	0.991611	CS pos: 43-44. Pr: 0.9054

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_28146T0-p1.