CAZyme Information: PHYCI_280221T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_280221T0-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262	PcinCBS144-22_SC0068|CGC1	28576.59	4.5214

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0068:228752-230146(-)

Full Sequence      

MKITGVIASMGMLGVAAAGYCDVDQPTTQQSTPDVTPAATTTTSSTSSPAGNSSFARFFD
QDRFHAMFPDAVPLYNFNGLVNAANKYTTFANTGNDTNDKRELAAFLAQTAHESDNFKAA
EEYARNTYTVWQYCDNSTIPCAPGRRYHGRGPIQLSWNYNYYHAGEALGIDLLDNPDIVA
TDTDVTWMTALWYWMTPQGGRVIHDVVAGENGFAQSTDIINGALECGPSAPNKINEQQRI
KYYAKMCEALDVQPLGNSSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	57	260	1.2e-64	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	3.04e-72	59	260	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	1.10e-54	75	260	25	232	Chitinase class I.
225720	COG3179	8.08e-11	61	224	6	187	Predicted chitinase [General function prediction only].
381610	chitinase-like	0.010	105	196	1	75	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD28125.1|GH19	3.97e-138	1	262	1	260
AAN31509.1|GH19	2.40e-135	50	262	22	234
AIG55513.1|CBM1|GH19	3.26e-60	58	260	24	222
AKJ27151.1|CBM12|GH19	4.25e-60	63	260	167	363
BAY91283.1|CBM50|GH19	3.18e-59	49	260	153	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	4.54e-51	63	260	7	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	2.17e-49	64	260	13	206	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	1.19e-48	64	260	12	205	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
7V92_A	4.25e-47	75	260	29	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V91_A	1.19e-46	75	260	29	236	Chain A, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P05315|CHIT_SOLTU	1.14e-47	75	260	106	313	Endochitinase OS=Solanum tuberosum OX=4113 PE=2 SV=1
sp|P52405|CHI3_SOLTU	2.48e-47	75	260	96	303	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
sp|P24091|CHI2_TOBAC	8.05e-47	75	260	102	309	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1
sp|P08252|CHI1_TOBAC	9.11e-47	75	260	107	314	Endochitinase A OS=Nicotiana tabacum OX=4097 GN=CHN48 PE=1 SV=2
sp|P52404|CHI2_SOLTU	9.28e-47	75	260	94	301	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005151	0.994808	CS pos: 18-19. Pr: 0.9359

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_280221T0-p1.