CAZyme Information: PHYCI_264511T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_264511T0-p1
• CAZy Family: GH30
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		85083.15	4.7774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0004:675058-678872(-)

Full Sequence      

MKSWLAASMLSLPGVATALSAGQLNSYDAQARAIVDGFSAAQVIGQMTQLDLSLIINGSD
HSLNETAVRAFAKLNVGSYLNTNWGDQPINGSYGFNATGFRSMIKRIQEITMEENGGHPM
IYGIDSIHGASYVAGAMLFPHEINSGASFNPDLVYKVGQVTARDTEAAGIPWIFGPILDI
SQNTLWARTYETYGEDPYLASVMGASYVRGLQSYNQTAACVKHFIGYSKTPTGHDRDNVL
MSDFDLLNYFMPPFKAAFEAGALSTMENYISLNGDPVVESSRILNDLLRTDLGFEGVLLT
DWNEIYNLHDFHRVASTREIAVSTSLQQTSIDVSMVPSDTDFITYAENMLKENPDQEARL
RESAKRVIKMKLQLGLYDNPVPGAEYYVSMVGNEKDKETALEMARESIVLLKNENDSLPL
PKSSSVFLTGHSADNVGYQCGGWTLIWQGHSGNAMFPHGVSVRKGLENMVGNDSFTYFNG
LQPDGSISDADMAKAVQLAGQHKYTIAVIGESSYTEKPGDIDNPALPEGQEKFIEKLAAT
GTKVVVVLFGGRPRLLGSIPDHAVAIIDGMLPCELGGQAIAEILYGDVNPSGKLPITYPK
DPANIAIPYNHRVTTRCMWDNCWMQWDFGAGLSYTKFNYSSVTLDKTAIANADDTLTATV
TVTNVGSRAGKETVMLFLIQPYRKISVPEMKMLKKFKKIELQAGESADVSFSLSSEDWGV
YQPQIGHGLKRIVEDSNYVVAIKPDTWCNVYGDNITNPLCAQFTIDTSSGAGTVSAGVQL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	316	8.9e-62	0.9074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.00e-114	5	746	9	754	beta-glucosidase BglX.
224389	BglX	4.91e-71	47	445	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.60e-54	133	713	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.15e-51	44	368	6	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.37e-48	408	634	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	779	2	776
UIZ29613.1|GH3	0.0	1	768	47	822
UIZ29432.1|GH3	0.0	1	768	2	766
CCA27737.1|GH3	5.12e-292	34	765	71	808
UIZ27116.1|GH3	6.38e-289	47	765	1	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.81e-124	42	753	28	749	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5Z87_A	7.80e-82	101	746	106	774	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	2.01e-81	39	727	15	707	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.03e-80	39	727	15	707	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	1.05e-80	39	727	16	708	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.11e-139	34	742	83	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.08e-123	42	753	50	771	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	4.20e-89	105	742	48	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.05e-86	119	716	105	728	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.90e-84	101	746	86	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000359	0.999612	CS pos: 18-19. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_264511T0-p1.