CAZyme Information: PHYCI_259130T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_259130T0-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		52275.56	4.5011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0425:12636-14042(-)

Full Sequence      

KTSIDFYLKTRAEQGYNVVQTVVISELNGTTRSNFYGDLPFNNSDPSKPNEAYFELIDWT
VDLAAGYGILLALVPTWGMYVNGGWHSTERIFNESSAYDWGQYIGNRYPGLPKILGGDSN
ALWSWNMSEVQAAYAEDPDQDLPSLLAPIEDTSSVWASMRRGLKDSEREVGYESMVLYHP
TNSWIVKPEVTPLPYGHIMLPDEEDRVSVDAVQSGHATPDPTSKFTPVAGWDSTKNYENI
AEMRDKFTGPVLDLENHYEGAHDSFDLTRLIWNASHIRTGLYHGVYGGATGFTYGANSVW
QMYEPRSDLLRDSDYYPAQINQNTSGSWRRDIFFEGATQIQYVTKPLQNLTTAILESLEP
ARELLTSPSDHTGKSVNTYEGTRYISVLASKSRDRYYVYTGHGDSFSLQLDNGSGARTGS
ATWFSPRDGQYSANSTVSVPETGNGTRVDFTPPSTGGIDHDWMLVLTF

Enzyme Prediction     

No EC number prediction in PHYCI_259130T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	4	438	1.3e-62	0.866504854368932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	3.24e-98	1	350	29	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	2.42e-13	377	467	10	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	3.85e-151	1	464	67	531
KAF3763706.1|GH140	1.71e-138	1	467	66	536
KNX49908.1|GH140	6.83e-65	4	463	53	514
KAE8156220.1|GH140	4.41e-63	5	466	66	507
KAE8421181.1|GH140	1.01e-59	5	466	66	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.46e-13	5	430	55	414	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.32e-11	5	430	55	414	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYCI_259130T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997720	0.002303

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_259130T0-p1.