CAZyme Information: PHYCI_255456T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_255456T0-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		36026.63	9.5729

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0285:12011-13030(+)

Full Sequence      

MQLLAPLIALLGLAATAEGACGGPNARITPPTGAIVVDASGAHAGSFRTLAQGVAKLSTT
TAQQTVFVYPGVYREQVTVPLLNGPLVLQGYTCDTKSYAANQVTITQAKAQKDIPASVVK
NRNDLTTTLLLKSDNVKVYNLNVANTAGNVGQAIAVKADGANSGFYACKFLGFQDTLYAN
KGPNLYARSYISGAVDFVFGQYAKAWFESCDIVSTGKGCIAANGRDSATNPSEFIFNNAN
VTGTGGVGTAYLGRPWKPYSRVVWQNSQLSNVINPQGWQKWNGNNNVGNVYLKEYNNRGT
GAATNQRVSFGGVVSKPVPITDILGANYKTQWWVDTNFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	36	310	3.9e-72	0.9201388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	1.79e-48	35	310	13	268	putative pectinesterase
395871	Pectinesterase	7.55e-44	35	312	2	276	Pectinesterase.
178113	PLN02497	8.80e-42	35	310	34	302	probable pectinesterase
178372	PLN02773	1.55e-40	30	310	2	278	pectinesterase
178276	PLN02671	5.25e-39	35	308	61	331	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	1.96e-174	1	339	1	338
AFM08806.1|CE8	4.58e-173	1	339	1	338
ACO54873.1|CE8	2.11e-154	6	339	7	344
ABQ63096.1|CE8	8.55e-154	6	339	7	344
ACO54875.1|CE8	8.93e-142	15	339	16	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.03e-58	25	338	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.45e-58	25	338	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.81e-33	35	312	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	9.28e-29	45	317	13	286	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.75e-12	36	306	7	315	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.43e-75	7	339	5	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.21e-74	27	338	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.30e-65	27	338	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.30e-65	27	338	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	3.65e-65	1	338	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999758	CS pos: 19-20. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_255456T0-p1.