CAZyme Information: PHYCI_24993T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_24993T0-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		35109.09	8.6418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0009:690284-691273(+)

Full Sequence      

MMSVLVAVEASCTGSNARTQPPSGAIVVDASGSYKGSVKTVSQGAAKLSSTTAQQTLFIF
PGTYREQVLIPALNGPLVVQGYTCNTMSYSANQVSITHAMAQKDLAANVQNRNDVISTLR
LKSNSGVKIYNINVANTAGNVGQAVATYVDGSAYGFYACKFSGYQDTVCANKGRELYARS
YIGGAIDFVFGEQAKAWFESCDIESVGTGCITANGNAGSSNPSEYVFNNARVYGSSSQTA
FLGRPWRPYARVVWQNSQLGNVINPKGWQVWDSSSSTSNVFLREFNNTGPGASTSQRVSF
SGKLSGPVSIESILGSSYKSEWWVDTNFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	26	303	4.9e-68	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	1.24e-41	23	305	8	273	putative pectinesterase
178113	PLN02497	3.37e-41	26	325	34	327	probable pectinesterase
395871	Pectinesterase	3.12e-40	131	302	93	276	Pectinesterase.
215357	PLN02665	4.72e-39	131	305	160	341	pectinesterase family protein
215117	PLN02176	6.49e-37	2	305	18	314	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	5.21e-155	3	329	13	346
ACO54869.1|CE8	1.59e-154	1	329	10	338
ACO54873.1|CE8	1.29e-150	11	329	22	344
ABQ63096.1|CE8	5.22e-150	11	329	22	344
ACO54874.1|CE8	1.17e-149	11	329	25	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.70e-57	18	328	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	6.63e-57	18	328	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.07e-30	19	302	4	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.46e-29	26	302	7	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	5.10e-12	45	287	57	350	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	2.31e-74	3	329	4	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.47e-72	1	328	6	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.38e-66	18	328	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.38e-66	18	328	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	6.70e-66	18	328	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000017

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_24993T0-p1.