CAZyme Information: PHYCI_2472T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_2472T0-p1
• CAZy Family: GH28
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		67716.87	4.1507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0008:690895-692808(-)

Full Sequence      

MYVGNSPIGENAGERTHSNVWRDTPEEEMYGSYLGPGANDAGSDVPMMRPTMNARPSTAV
HQDIAVGQLDADEATAGAGARKSFSGRKVVWPGALFLLVVTAAALALIAYFGVQEYNSAQ
SQQALTESATAVDSARKSTSVKSCLLPDYVTADGKIYAKDSSTGQKEQLVFTGINWSGME
NAEGVPHGLATKQSYLDDIAANLSDNGFNAVRLPLNAQMVIDNSAPNTKLFVNSLDTDLN
VDTYIDMIKKVVQGLGKQQIGVLLDIHKIDPNFTADTSEHLWYSDDYPIATMYKMYETLA
TELCSDLEYNIIGIDLKNEPVGGCWPEDDTDDYCASDVNWPRAVETIGNKILAICPNWLI
IAEGNYMTSATTEINGANVTYNDWYGASLQNASINPIKLDTTGKLVFAPHFYSPSVYPSS
YFFKKQSSSGATVSVTEYPNSTAGNELLKGALTAVLDNAFGNAVTEAGVPTFYGEFGGIY
GSAELLAGLTSTRVIEMLIQYANDMNMTGGFAWAINPDGSYDFNDEYKPDDPWQYGLYTS
SSWDAYHTDFVTGLQNLKGSGSFPCFSKITTVTSSTSGSGSATITVDSTNSSSTSATTAT
TTPAAASTTTSGSTAAAPAATTATATTTSSSATATAV

Enzyme Prediction     

No EC number prediction in PHYCI_2472T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	167	519	8.3e-144	0.9941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.08e-22	149	564	28	407	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.43e-19	183	519	11	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75347.1|GH5_20	0.0	1	576	1	576
ABL75348.1|GH5_20	0.0	1	574	1	575
UIZ24458.1|GH5_20	0.0	1	575	1	572
CCA26601.1|GH5_20	8.23e-192	20	567	22	565
CCA27479.1|GH5_20	8.59e-191	5	576	13	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	3.20e-32	149	518	8	349	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	4.35e-32	149	518	8	349	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.54e-31	149	518	41	382	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.54e-31	149	518	41	382	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	5.16e-31	149	518	41	382	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.40e-28	167	518	52	355	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P50400|GUND_CELFI	2.00e-22	162	435	56	329	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000027

TMHMM  Annotations     

Start	End
89	111