CAZyme Information: PHYCI_24234T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_24234T0-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483		52921.46	4.2595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0005:691457-692905(+)

Full Sequence      

MLTSWAAVLGCFAAFSALPVDARVMGDDVYNSQAQAIVDGFSVAQVLGQMTQINIGQVLN
SDYSLNEDSVRTYAKLYVGSYLNTPWGSEIDGKWGWNATEWRAIVSRIQEITMEENGGHP
MVYGIDSVHGAIYVAGAVIFGQEINSGASFNPDLVYEVGKITGRDTEAAGIPWIFGPILD
LAQNPLWARTYETFGEDPYLCSVLGDAIIRGLQSNNQTAACMKHFVGYSKTPTGHDRDGV
TMADFDLLNYFVKPYQAGIAAGALSTMENYISINGIPVVANTKILEDLVRNDLAYDGVVV
TDWAEINNLKDWHRVVDTYDEAVRLSLTRTALDMSMVPYDTEFTTYATEMLTNYPEYEPR
LRESAKRVIKMKLKLGLYETPVPGAGYEYLVGNDDDKAVALDLARESIVLLKNDNNILPL
ANGSSVFLTGHSADNIGYQCGGWSVAWQGYSGNDMFPNGVSVRQGLENVVGNNSFTFFNG
LSA

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	324	3.8e-60	0.9212962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.35e-65	55	445	7	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	4.72e-54	120	473	105	453	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.13e-48	47	369	6	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.94e-24	134	475	108	463	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.81e-09	408	472	1	58	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	2.94e-225	27	481	23	479
UIZ29613.1|GH3	1.04e-195	1	481	46	534
UIZ29432.1|GH3	2.82e-190	1	481	1	478
CCA27737.1|GH3	5.47e-181	32	483	66	521
UIZ27116.1|GH3	1.28e-172	50	481	1	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.93e-84	27	450	10	439	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
1LQ2_A	3.07e-58	29	452	4	439	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	3.23e-58	29	452	4	439	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
3WLI_A	3.46e-58	29	452	8	443	Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLO_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],6JG1_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6JG2_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6MD6_A CRYSTAL STRUCTURE ANALYSIS OF PLANT EXOHYDROLASE IN COMPLEX WITH METHYL 2-THIO-BETA-SOPHOROSIDE [Hordeum vulgare subsp. vulgare]
6JGQ_A	6.66e-57	29	452	8	443	Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGR_A Crystal structure of barley exohydrolaseI W434Y in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGS_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with 4I,4III,4V-S-trithiocellohexaose. [Hordeum vulgare subsp. vulgare],6JGT_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.01e-89	37	469	83	533	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.29e-83	27	450	32	461	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	2.68e-44	104	471	50	434	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.71e-41	120	471	105	451	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	1.08e-40	42	473	46	453	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999777	CS pos: 22-23. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_24234T0-p1.