CAZyme Information: PHYCI_241799T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_241799T0-p1
• CAZy Family: GH18
• CAZyme Description: Fucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43546.93	7.0266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0127:71325-72470(+)

Full Sequence      

MCRSIVQKLRTRVQQQFEFAKNSRKLNPAFLELWYHNLFVAEGNNPFIVAYTPESSYASI
VFECIFKTIFESHGRPILVVPEKTLHISYGNKPDVFIFSIFDADCDPMTNPECPQMIAQY
MHQYLLPVDGSSKLMMISGEAIDTQTLDDRVPLLSSVSSVTRTQHVYLPVVSISFAERLL
HTPLELLSPTTYKPSTRRFCAYLYARCERPHREHMFDLLNAMEPVDALGICAGSSRPPDK
AYKESRYSKWFNDEAVILYQRYKFVIAFENSAEPGYLTEKLANPLLAGSVPIYLGNSTTA
SQLFNPDSYIDCGRFEELNECAEFVLKVHKSPKLYAKLRNERLIKNITAFNEAFSWHPSV
PSRYLADKVAQMLDLDKHSSA

Enzyme Prediction     

No EC number prediction in PHYCI_241799T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	188	353	1.1e-35	0.44668587896253603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	1.35e-15	211	337	17	132	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEJ34901.1|GT10	2.93e-21	155	346	36	215
BAV61775.1|GT10|GT25	7.15e-20	155	346	391	570
QTF49584.1|GT10|GT25	7.15e-20	155	346	391	570
AKI81328.1|GT10|GT25	7.15e-20	155	346	391	570
BAV62761.1|GT10|GT25	7.15e-20	155	346	391	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	2.53e-11	194	347	177	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.69e-10	194	347	177	316	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	1.27e-20	155	346	391	570	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q9VLC1|FUCTB_DROME	1.22e-12	192	343	167	316	Alpha-(1,3)-fucosyltransferase B OS=Drosophila melanogaster OX=7227 GN=FucTB PE=2 SV=2
sp|Q6A1G3|FUT10_XENTR	4.15e-12	201	347	207	351	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus tropicalis OX=8364 GN=fut10 PE=2 SV=1
sp|Q68FV3|FUT11_RAT	1.03e-11	202	337	214	350	Alpha-(1,3)-fucosyltransferase 11 OS=Rattus norvegicus OX=10116 GN=Fut11 PE=2 SV=1
sp|Q8BHC9|FUT11_MOUSE	1.82e-11	202	337	209	345	Alpha-(1,3)-fucosyltransferase 11 OS=Mus musculus OX=10090 GN=Fut11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999807	0.000215

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_241799T0-p1.