CAZyme Information: PHYCI_241648T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_241648T0-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	PcinCBS144-22_SC0126|CGC1	33646.13	6.0751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0126:67625-68629(+)

Full Sequence      

SGKEVILSGGAINTPQLLLLSGVGDADHLKEIGVPLVHHLPAVGNNMEDHIGAHMQFACK
QPITLYNASKRYPHNVLKIGYEWFTSKTGPGATPHCEVGGFIRTAPGKEQPDLQVVFSPC
AVDERCQMREDIGHAITGHISLLRGSNNGTLKLRSANPRDHPVIDPKYMADEDRRIALRE
GVKLTREIFAQSAFEEFCGGGISPRDSVQSDEEIDAWLRKYSGAEFHVSCTARMGVDDNS
VVDPQTRVHGLEGLRIVDASIMPNIVSGNTNAPVIMIAEKAADMILGNPALPKADVPVYE
PSNWETTQR

Enzyme Prediction     

No EC number prediction in PHYCI_241648T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	286	5.8e-82	0.5352112676056338

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.44e-147	3	309	252	555	choline dehydrogenase; Validated
225186	BetA	1.51e-84	1	291	254	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.07e-43	149	281	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.08e-16	2	286	279	577	Protein HOTHEAD
366272	GMC_oxred_N	1.61e-07	3	50	182	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	2.32e-128	1	309	275	581
AFP03409.1|AA3_2	1.98e-104	3	306	135	437
AWP09430.1|AA3_2	4.22e-98	3	302	269	567
CAB3230510.1|AA3_2	3.81e-97	1	305	272	575
ANI26486.1|AA3_2	8.83e-97	3	306	320	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LJP_A	1.26e-48	3	285	263	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.76e-48	3	285	263	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.76e-48	3	285	263	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
6YS2_AAA	1.05e-47	2	287	258	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	2.03e-47	2	287	258	562	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NE62|CHDH_HUMAN	4.73e-102	1	306	288	592	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	4.26e-101	3	306	295	597	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	4.39e-100	3	306	292	594	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q3K5H3|BETA_PSEPF	8.42e-83	3	299	254	547	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
sp|Q39A44|BETA_BURL3	3.55e-81	3	299	253	546	Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_241648T0-p1.