CAZyme Information: PHYCI_240930T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_240930T0-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		46945.15	6.7599

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0121:128097-129584(+)

Full Sequence      

MRLQFAIATVLALVAKSANAFTVGSPEGLAAGATGGASGKTVYPTSTSELVSYLASSEPL
VVVLNKTFDFRGTEGTTTETGCRPDYTRECMAKNNGFKSQDVIIQGGSMENTGGCTGGTE
VKVTYDNATLKLMTVAGNKTIRGIGKSGVIKGKGLKLNGDNIIVQNIHITELNHHLVWGG
DAIYMQGTNGGGTAMKKIWLDHIKISRVGRQFITTNKASTDSMTISNSDFDGNTDYSASC
DGHHYWSFIFYGVTRFSMLNNYIHGTSGRSPKIGGDSAAKVVAHVANNFWGNNSGHSFEI
GANAWVLAEGNYFRDTKMPLFNKEDEGALYAASSEDQCKSYLGRSCAANELVDSGAFTSR
NGETALKTIKSVSTFTSRSEQQQEQAQEQQSNDWEQGNWGMWGDQYQSRKLAVQTGDLEK
EWQQTTGNFGVGKLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	122	314	2.8e-78	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.04e-33	121	313	2	186	Amb_all domain.
226384	PelB	2.01e-13	96	320	51	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19258.1|PL1_4	6.41e-206	2	333	3	333
AHX74068.1|PL1_4	7.50e-193	10	435	11	400
ADN18834.1|PL1_4	1.51e-192	10	379	11	380
AHX74069.1|PL1_4	1.17e-187	2	435	3	441
ADN18835.1|PL1_4	4.74e-187	2	435	3	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.84e-76	23	358	4	323	Pectin Lyase B [Aspergillus niger]
1IDK_A	4.44e-75	24	377	5	345	Pectin Lyase A [Aspergillus niger]
1IDJ_A	5.97e-72	24	377	5	345	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	2.86e-91	9	366	9	351	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	2.86e-91	9	366	9	351	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|B8NVB7|PELD_ASPFN	1.44e-86	1	355	1	338	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	1.44e-86	1	355	1	338	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|Q8NJK6|PELF_ASPNG	4.18e-84	9	358	9	345	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999778	CS pos: 20-21. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_240930T0-p1.