CAZyme Information: PHYCI_240596T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_240596T0-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532		58841.06	4.4832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0119:40947-42545(+)

Full Sequence      

MKTPSAVAALISLTSLATSAVATPSWHDLAISAPRYGRYLYRTASEEPFFWQADTAWELI
HKLNKTSIDFYLKTRAEQGYNAVQTVVISENNGTTRPNFYGDLPFNDSDTTQPNEAYFEL
VDWTVNLAASYGILMVLVPAWGNWISGGWHGTEESLFNESTAYEWGKYIGDRYPGLPKIL
GGDTNCLWARNLMAASISYAASPNVDPATLVGTIEDTTSLWVRMRSGLKDGEEAQGYEPA
ILFHPTAGRIARPVSTPEALGHLMLPKEECRVSIDAVQSGHATPESLGAFTPFEARDSTK
NYELIAAMRDGFTGPVLDLENHYEGAHYNFDRDYPIWNASEVRTGLYNGVYSGSAGFTYG
ANSVWQMYEPRSDLLRDSDYYSPSVNQNASGSWRRDIFFEGATQIQYVTKPLQNLSVEEL
ELLQPARHLLSSPSEYTDVAVNAFDSTRFISVLASGNHDRYYVYTGHGDSFSLDLSTCSE
RSGTARWFSPRDGQFYADSTVNVAASGNGTRVDFTPPSGGGVDNDWLLVLEC

Enzyme Prediction     

No EC number prediction in PHYCI_240596T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	37	526	1.3e-74	0.9733009708737864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.72e-117	37	415	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	7.04e-13	451	531	5	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	1.29e-158	15	531	18	534
KAF3763706.1|GH140	1.66e-153	15	530	16	535
KNX49908.1|GH140	3.87e-80	28	531	13	518
KAE8313632.1|GH140	5.22e-72	28	531	26	508
KAB8225539.1|GH140	2.82e-71	28	531	26	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.59e-20	26	530	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.49e-18	26	530	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYCI_240596T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000545	0.999419	CS pos: 22-23. Pr: 0.9763

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_240596T0-p1.