CAZyme Information: PHYCI_234923T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_234923T0-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359		38647.41	4.4143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0084:112999-114192(-)

Full Sequence      

MVRVVSLSAAAAVAVLASSTAALDQKLYGVNYDLRQGPDWDPSRCKSADTIASDLKVLST
ITSNVRTYSLSDCDVSGVLTAAKKLSLTVWLGVWVSDDSKVYDAEVTAFKKLISAGLIDS
NVVGINVGSEAVYRKDITAEQAIEYVTDFKKVMSDNKISVPVSITDIIDTFVQYPDMLKA
GDIVTINQFPFWEKIEANKAAAQFNKRIQPLIKMAGDMEVIISETGWPTAGTATNGSVAS
EENGATYLNDFYELAEAKKWKYYYFAGFDTPYKEKQEDDATTVESHFGIFDETGTMKTAY
SNLKFTKTGDYSTSSGSSTTTSGSSSEAVGTTADSGSSQLMAASLAACLGVVSTMLWSL

Enzyme Prediction     

No EC number prediction in PHYCI_234923T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	43	297	3.7e-24	0.9485530546623794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.67e-43	37	290	51	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.05e-19	29	297	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	2.65e-84	16	308	11	303
AIG55438.1|GH17	2.76e-83	17	308	13	314
AIG55390.1|GH17	4.30e-81	3	307	2	313
AIG56392.1|GH17	1.92e-79	22	307	19	310
AIG56195.1|GH17	5.51e-74	15	308	5	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.39e-37	25	289	35	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.23e-36	25	289	35	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	2.97e-24	45	312	40	313	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	7.16e-24	41	297	31	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	9.32e-23	41	297	31	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|A2QN74|BTGC_ASPNC	5.60e-21	23	297	383	670	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|Q5B430|BTGC_EMENI	2.38e-20	40	297	363	635	Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003196	0.996784	CS pos: 21-22. Pr: 0.9604

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_234923T0-p1.