CAZyme Information: PHYCI_231758T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_231758T0-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		32821.96	5.8811

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0069:186022-186900(-)

Full Sequence      

IKEIADTGVLNTVRVPVGHWIIRDATTAPGTEGDMFARGGLKYLDALINDWAVKYNIAVM
ISLHAHQGSQNGIEHSAPVTLNTVGWSTSQVNVDNSLKFATFLAARYKNSPAFLGLNLMN
EPVPPVDGNVLRNYYIDAYKQIRATGNDCILLVTPFLNDQDPDHLKGMIGAPEYTNVWNE
IHAYFIWGYEGTTEEQVLAVIDQYDQSHLKAAPTNNRLFLGEWCMGGPPDSRGIFQNIDN
FRELGRKQLAYFNADTTGGWAFWTWRNSDETVKRTGWSMRYLIRNGYLNLNA

Enzyme Prediction     

No EC number prediction in PHYCI_231758T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	9	270	8.9e-41	0.9025270758122743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.96e-18	1	289	79	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.64e-08	1	265	30	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15861.1|GH5	8.91e-79	1	292	86	376
UIZ29723.1|GH5	1.11e-78	10	291	83	363
AAM18484.1|GH5	8.42e-77	10	290	91	370
UIZ29004.1|GH5	3.22e-74	1	283	112	397
UIZ29069.1|GH5	1.65e-73	1	285	121	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	8.24e-07	11	277	69	369	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.67e-06	11	277	69	369	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	1.15e-18	4	286	91	388	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q5AIA1|EXG2_CANAL	2.50e-17	2	288	109	439	Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXG2 PE=1 SV=2
sp|Q0C8Z0|EXGB_ASPTN	2.51e-17	10	266	113	371	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	2.85e-16	10	266	110	367	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	3.79e-16	1	266	102	367	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_231758T0-p1.