CAZyme Information: PHYCI_231735T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_231735T0-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		37275.41	7.6436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0069:193278-194267(+)

Full Sequence      

IKEIADTGVLNTVRVPVGHWIIRDATTAPGTEGDMFARGGLKYLDALINDWAVKYNIAVM
ISLHAHQGSQNGIEHSAPVTLNTVGWSTSQVNVDNSLKFATFLAARYKNSPAFLGLNLMN
EPVPPVDGNVLRNYYIDAYKQIRANGNDCILLVTPFLNDQDPNHLKGMIGAPEYTNVWNE
IQAYFIWGYEGKTEEQVLAVIDQYDQSHLKAAPTNNRLFLGEWCMGGPPDSRGIFQNIDN
FRELGRKQLAYFNADTTGGWAFWTWRNSDETVKRTGWSMRYLIRKWIPQVCCLRIGFNGS
RSELCWVMTGSHQVRFCILPNCHHCRMPR

Enzyme Prediction     

No EC number prediction in PHYCI_231735T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	9	270	2.2e-39	0.9025270758122743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.46e-19	1	283	79	376	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.34e-07	1	265	30	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15861.1|GH5	1.41e-75	1	285	86	369
UIZ29723.1|GH5	8.88e-74	10	284	83	356
AAM18484.1|GH5	8.38e-73	10	284	91	364
UIZ29004.1|GH5	3.08e-70	1	283	112	397
CCA15900.1|GH5	6.95e-70	1	284	176	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.45e-06	11	277	69	369	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	8.09e-06	11	277	69	369	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B5X8|EXGA_EMENI	2.05e-16	4	283	91	385	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|B8NBJ4|EXGB_ASPFN	2.89e-15	1	286	103	388	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgB PE=3 SV=1
sp|Q5AIA1|EXG2_CANAL	2.94e-15	2	289	109	441	Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXG2 PE=1 SV=2
sp|Q0C8Z0|EXGB_ASPTN	3.07e-15	10	266	113	371	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	4.19e-15	1	280	103	380	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_231735T0-p1.