CAZyme Information: PHYCI_231331T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_231331T0-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	PcinCBS144-22_SC0068|CGC1	42159.48	3.7634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0068:27545-28792(-)

Full Sequence      

MAASTANQATTYAGSIASSHATASSSATTSDFASTAASDNTESTDASAVTSSAGSATYAS
STAASTTSASAAATTASSSTNTTTTAGCTLSGTYSEGTDVSSCSSIVISDLTVPKGVTLD
LTDIADGATITFEGTTTFGEEEWDGPLILLTGTDLTVTGTGTLDGQGSWYWEQGTSISKP
VFFRLKKVDSSTLKNFNIKNSPYRTFSILDCEDTTLTGLTLDSSAGDDTAKNTDGFDLSR
NVGLTISDCTVYNQDDCLAMQSSNDTTFSGNTCSGGHGISIGSLGGDSVTESDIVSGLTV
KNNKIVDSVNGIRIKTIIDLYGTVTGATYTDNTLSNVENAIVIHSDYSKSEGGYTGDATS
KVAITDITISGLSGTADDIYDILVNPDVVSGWTFSDITVTGDTGSCSGEPSGVGC

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	100	409	1.1e-63	0.9415384615384615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.70e-77	110	415	8	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.05e-24	155	385	141	357	polygalacturonase
178580	PLN03003	3.23e-24	148	382	107	337	Probable polygalacturonase At3g15720
215120	PLN02188	1.77e-23	155	376	124	348	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	4.25e-22	155	376	145	368	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABV82742.1|GH28|3.2.1.15	1.25e-220	88	415	185	512
ADN18847.1|GH28	5.35e-183	88	415	34	361
UKP15075.1|GH28	1.05e-178	88	415	196	523
ABV82740.1|GH28|3.2.1.15	1.23e-178	88	415	31	358
ADN18856.1|GH28	4.40e-177	88	415	143	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NHC_A	1.99e-77	88	415	3	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	1.38e-73	88	415	11	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	1.38e-73	88	415	11	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	3.06e-73	88	415	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
2IQ7_A	2.63e-72	88	414	3	336	Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_B Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_C Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_D Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_E Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_F Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini],2IQ7_G Crystal structure of the polygalacturonase from Colletotrichum lupini and its implications for the interaction with polygalacturonase-inhibiting proteins [Colletotrichum lupini]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CMU3|PGLR1_ASPTN	1.52e-78	88	415	35	368	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1
sp|Q12708|PGLR1_SCLSC	2.17e-78	101	415	62	380	Endo-polygalacturonase OS=Sclerotinia sclerotiorum OX=5180 GN=PG1 PE=3 SV=1
sp|O42824|PGLR_PENJA	6.59e-78	88	415	38	371	Polygalacturonase OS=Penicillium janthinellum OX=5079 PE=3 SV=1
sp|Q2UHL4|PGLR1_ASPOR	8.26e-78	88	415	34	367	Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgaI PE=1 SV=1
sp|P41750|PGLRB_ASPFA	8.26e-78	88	415	34	367	Endopolygalacturonase B OS=Aspergillus flavus (strain ATCC MYA-384 / AF70) OX=1392242 GN=pgaB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_231331T0-p1.