CAZyme Information: PHYCI_22434T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_22434T0-p1
• CAZy Family: GH114
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		44482.92	9.4804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0768:959-2218(+)

Full Sequence      

MQILRLVIVAVAAFAVQGSQAGSSDYSVEQSSPKQGTTTKASISTGSASGLAAGTTGGGN
IAPVYPASLDDLRNYLKDSQPRVIVLTKTFDFRGSEGSRTETGCRPKSNRDCLAKNNGYK
GQDVILQSGGFANTGGCVQGTSVKITYDVAATKNPLVVSSNKTLRGLGTSGVIKGKGLWL
NGNNIIIQNIHITQLNPHLIWGGDAIYIQGLNGGKTPMERIWIDHVKISNLGRQMIATGS
ASVKSMTISNCEFDGRTQYSATCDGNHYWTFLFLGTQTQVTLVNNYVHNTSGRSPKVAEN
SVVHAVNNYWANNTGFSFDVLQNGNVLLEGTYFENTAIPNKHDAETVGAIIAPSSSMQSA
CKSTLGRNCVENVVSNCGSLTGYRESAALSNTKKVASYYKPTSAKKFGSTSQNFGVGQL

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	145	335	3.8e-80	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.87e-25	143	336	2	189	Amb_all domain.
366158	Pec_lyase_C	1.99e-09	153	333	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	3.09e-09	118	385	51	319	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19249.1|PL1_4	6.71e-228	1	419	1	432
AHX74067.1|PL1_4	6.71e-228	1	419	1	432
ACR19252.1|PL1_4	3.68e-225	1	419	1	432
ACR19255.1|PL1_4	6.25e-223	1	419	1	398
ACR19247.1|PL1_4|4.2.2.10	1.03e-221	1	419	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	5.84e-71	46	418	5	359	Pectin Lyase B [Aspergillus niger]
1IDK_A	3.92e-68	46	381	5	322	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.32e-65	46	372	5	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	6.50e-86	50	381	29	342	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	2.54e-84	45	419	25	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.54e-84	45	419	25	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|B8N316|PELF_ASPFN	5.04e-81	36	419	15	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	5.04e-81	36	419	15	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999737	CS pos: 21-22. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_22434T0-p1.