CAZyme Information: PHYCI_223300T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_223300T0-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		21985.89	6.0685

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0038:104319-104972(-)

Full Sequence      

MKLATTFSAIVGSVVFLANHATLVTAECSDVHIVFARGSGEMAGLGICGEPLVSGITSNL
GGKSVSSYAVNYLASMDQTSAGPGATDMTNHVVSVAQECPNTVFVLGGYSQGASVTDIAI
GIKTMLGSGDSIPENLASRIKAVVTFGNPLKLMGQTIESSSSTYGSKAIEFCSQGDPVCG
NGFNTMAHVTYTTDGSVTSAAEKAAALVKGGARTLRT

Enzyme Prediction     

No EC number prediction in PHYCI_223300T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	202	2.7e-52	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.44e-43	28	208	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEY60079.1|CE5	1.43e-120	1	216	1	214
AAY43367.1|CE5	1.85e-116	1	210	1	208
AAO92431.1|CE5	2.36e-107	1	216	1	222
AAO92430.1|CE5	2.36e-107	1	216	1	222
AAX55266.1|CE5	5.48e-107	1	216	1	216

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	5.62e-17	28	200	79	241	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1BS9_A	6.54e-12	27	194	1	193	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
2AXE_A	6.54e-12	27	194	1	193	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1G66_A	9.03e-12	28	194	2	193	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
4OYY_A	1.96e-11	28	194	17	179	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	5.89e-60	26	209	34	219	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P9WP43|CULP1_MYCTU	5.21e-37	28	205	35	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut7 PE=1 SV=1
sp|P63880|CULP1_MYCBO	5.21e-37	28	205	35	210	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1
sp|P9WP42|CULP1_MYCTO	5.21e-37	28	205	35	210	Carboxylesterase Culp1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2037 PE=3 SV=1
sp|P0A537|CULP3_MYCBO	1.82e-35	28	193	44	216	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999747	CS pos: 26-27. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_223300T0-p1.