CAZyme Information: PHYCI_219007T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_219007T0-p1
• CAZy Family: GH1
• CAZyme Description: Chitin synthase/hyaluronan synthase (glycosyltransferases)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
899	PcinCBS144-22_SC0024|CGC1	100458.57	6.2971

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0024:357729-360495(-)

Full Sequence      

MLEQDAGDYVSSDTEQYDAAPSSGLSTPDGPDVWRDTRPSSHSYVDEPHADQPLERQLSY
RQPGLNPAVEETYEAAFRLIQLAAEAERSGNPLQAIQLYTDAGDVLIKVGKGEPDPLLKQ
GIREKANEIMKRAEELDEWYYSVQESARKAALPPQLQIQRTQVPRVQEAWQGRKPTLSQA
PEFTHMRYTAVSTKDPVKFSDDGFQLRVEETGKKIRVFITITMYNEEGSELQGTLTGIAR
NLEFMAEQWGDRAWESVAVAVVSDGRTKASASCLDFLTGLGAFDEEIMTVTSMGVDVQLH
LFEATVQLVRDDNFESFYPPIQLIYALKENNAGKLNSHLWFFNAFSEQLLPTYTVLVDVG
TIPGPTSIFRLVRSMDRNPQIGGVAGEIAVDHPNYFNPVIAAQHFEYKISNIMDKSLESV
LGFISVLPGAFSAYRYEAIRAEKGVGPLPEYFKSLTTSTRDLGPFKGNMYLAEDRILCFE
LLARRGRNWTMHYVKDAIARTDVPETLVDLIKQRRRWLNGSFFAGLFAISNFSRVWKESG
HSLPRKIVLTLQFIYLSVQNVLSWFLLSNLFLTFYYVLTLTLYSKYPALLAIVLGIYLAI
VGGIVVFALGNRPEKRTAAFYSFSYVFMGLVMLVVSVISIYGLVADVSVTDPRKNLATCS
VSNFELVGGVVTAIGLVFASAFIHGEFSVLLSTLQYYFMLPTFVNILGIYAYSNLHDLSW
GTKGLETAGHGTAKMAQGNGDLKEIVAQQKRIEAEKQRAAKEKEDVDNSFRAFRSSLLLF
WLVTNAVWMYCMTYFVSSSCYLKFISYVVAIFNIVRFLGSAVFLCFRIARRLGTCGASRA
GGVGRNYQAHLPAEWQAHYKRSSNATTETGTTGTGQVGLNISELSSPTTTNYNNMEDAR

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	223	375	2.7e-45	0.9938650306748467
GT2	354	600	1.4e-23	0.4459203036053131

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	3.22e-84	219	524	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	1.13e-60	223	375	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	2.91e-31	303	645	96	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	1.91e-21	353	721	204	490	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	2.60e-16	323	444	55	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE62521.1|GT2	0.0	33	865	77	937
ACA49151.2|GT2	1.12e-296	112	835	54	781
AAC49743.1|GT2|2.4.1.16	1.35e-293	33	778	74	789
ADE62520.1|GT2	1.17e-189	72	854	103	878
ACA96933.2|GT2	1.69e-175	76	870	33	833

PDB Hits     

PHYCI_219007T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	2.40e-294	33	778	74	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P87073|CHS1_PHYB8	7.12e-127	182	828	134	838	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	2.99e-126	182	828	151	855	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30594|CHS1_RHIOL	2.48e-123	182	828	149	855	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30601|CHS2_EXODE	3.42e-123	182	828	220	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

Start	End
561	583
588	610
623	645
666	683
693	715
777	799
804	826